Recombinant Human MALSU1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MALSU1-964H |
Product Overview : | C7orf30 MS Standard C13 and N15-labeled recombinant protein (NP_612455) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | MALSU1 (Mitochondrial Assembly Of Ribosomal Large Subunit 1) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include ribosomal large subunit binding. |
Molecular Mass : | 26.2 kDa |
AA Sequence : | MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MALSU1 mitochondrial assembly of ribosomal large subunit 1 [ Homo sapiens (human) ] |
Official Symbol | MALSU1 |
Synonyms | MALSU1; mitochondrial assembly of ribosomal large subunit 1; mtRsfA; C7orf30; mitochondrial assembly of ribosomal large subunit protein 1 |
Gene ID | 115416 |
mRNA Refseq | NM_138446 |
Protein Refseq | NP_612455 |
MIM | 614624 |
UniProt ID | Q96EH3 |
◆ Recombinant Proteins | ||
MALSU1-2455R | Recombinant Rhesus Macaque MALSU1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MALSU1-964H | Recombinant Human MALSU1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Malsu1-3910M | Recombinant Mouse Malsu1 Protein, Myc/DDK-tagged | +Inquiry |
MALSU1-5211H | Recombinant Human MALSU1 Protein, GST-tagged | +Inquiry |
MALSU1-3834HF | Recombinant Full Length Human MALSU1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MALSU1-7969HCL | Recombinant Human C7orf30 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MALSU1 Products
Required fields are marked with *
My Review for All MALSU1 Products
Required fields are marked with *