Recombinant Full Length Human MAP2 Protein
Cat.No. : | MAP2-293HF |
Product Overview : | Recombinant full length Human MAP2 with N terminal proprietary tag; Predicted MWt 77.88 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 77.880kDa inclusive of tags |
Protein Length : | 471 amino acids |
AA Sequence : | MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEG LVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELT SADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQT AALPLAAEETANLPPSPPPSPASEQTVTVEEAAGGESALA PSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSG DRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTP GSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAI LVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSK IGSTDNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRH RPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVK IDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSN VSSSGSINLLESPQLATLAEDVTAALAKQGL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | MAP2 microtubule-associated protein 2 [ Homo sapiens ] |
Official Symbol : | MAP2 |
Synonyms : | MAP2; microtubule-associated protein 2; MAP2A; MAP2B; MAP2C |
Gene ID : | 4133 |
mRNA Refseq : | NM_001039538 |
Protein Refseq : | NP_001034627 |
MIM : | 157130 |
UniProt ID : | P11137 |
Products Types
◆ Recombinant Protein | ||
Map2-3919M | Recombinant Mouse Map2 Protein, Myc/DDK-tagged | +Inquiry |
MAP2-1351H | Recombinant Human MAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP2-047H | Recombinant Human MAP2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAP2-2633H | Recombinant Human MAP2 protein(401-500 aa), C-His-tagged | +Inquiry |
Map2-5462M | Recombinant Mouse Map2 protein, His-tagged | +Inquiry |
◆ Lysates | ||
MAP2-4512HCL | Recombinant Human MAP2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Customer Reviews (3)
Write a reviewI've been using them for several years now and they've been stable and I trust this product a lot.
It is very suitable for biological activity experiments, and the activity is good.
It can meet the needs of daily experiments and has good expression effect.
Q&As (6)
Ask a questionFuture research on MAP2 may involve its mechanism of action in neurological diseases, its interaction with other proteins, etc.
MAP2 may be associated with certain neurological diseases, such as Alzheimer's disease and Parkinson's disease. However, there is still insufficient research on this aspect.
There are still many controversial and unresolved issues in the current research on MAP2, such as its mechanism of action in neurological diseases.
The effects of MAP2 on neuronal structure and function, as well as its role in neurological diseases, can be studied through experimental methods such as cell culture and animal models.
MAP2 is unevenly distributed in neurons and is mainly concentrated in axons and dendrites, with a higher density in dendrites.
The MAP2 may affect the process of learning Xi and memory by affecting the structure and function of neurons. However, there is insufficient research on this aspect.
Ask a Question for All MAP2 Products
Required fields are marked with *
My Review for All MAP2 Products
Required fields are marked with *
Inquiry Basket