Recombinant Full Length Human MAP2 Protein

Cat.No. : MAP2-293HF
Product Overview : Recombinant full length Human MAP2 with N terminal proprietary tag; Predicted MWt 77.88 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 77.880kDa inclusive of tags
Protein length : 471 amino acids
AA Sequence : MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEG LVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELT SADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQT AALPLAAEETANLPPSPPPSPASEQTVTVEEAAGGESALA PSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSG DRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTP GSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAI LVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSK IGSTDNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRH RPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVK IDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSN VSSSGSINLLESPQLATLAEDVTAALAKQGL
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : MAP2 microtubule-associated protein 2 [ Homo sapiens ]
Official Symbol : MAP2
Synonyms : MAP2; microtubule-associated protein 2; MAP2A; MAP2B; MAP2C
Gene ID : 4133
mRNA Refseq : NM_001039538
Protein Refseq : NP_001034627
MIM : 157130
UniProt ID : P11137

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (3)

Write a review
Reviews
04/11/2023

    I've been using them for several years now and they've been stable and I trust this product a lot.

    02/02/2022

      It is very suitable for biological activity experiments, and the activity is good.

      05/19/2020

        It can meet the needs of daily experiments and has good expression effect.

        Q&As (6)

        Ask a question
        How about the possible aspects of future research on MAP2? 10/08/2022

        Future research on MAP2 may involve its mechanism of action in neurological diseases, its interaction with other proteins, etc.

        What is the relationship between MAP2 and neurological disorders? 08/21/2022

        MAP2 may be associated with certain neurological diseases, such as Alzheimer's disease and Parkinson's disease. However, there is still insufficient research on this aspect.

        What are some of the current controversies or unresolved issues in the study of MAP2? 11/05/2021

        There are still many controversial and unresolved issues in the current research on MAP2, such as its mechanism of action in neurological diseases.

        How can the function of MAP2 be studied experimentally? 06/05/2021

        The effects of MAP2 on neuronal structure and function, as well as its role in neurological diseases, can be studied through experimental methods such as cell culture and animal models.

        How about the distribution of MAP2 in neurons? 02/22/2021

        MAP2 is unevenly distributed in neurons and is mainly concentrated in axons and dendrites, with a higher density in dendrites.

        How about the relationship between MAP2 and learning Xi and memory? 10/12/2020

        The MAP2 may affect the process of learning Xi and memory by affecting the structure and function of neurons. However, there is insufficient research on this aspect.

        Ask a Question for All MAP2 Products

        Required fields are marked with *

        My Review for All MAP2 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2025 Creative BioMart. All Rights Reserved.

        Contact Us

        • /
        • Service lnquiry:

        Stay Updated on the Latest Bioscience Trends