Recombinant Full Length Human MAZ Protein, C-Flag-tagged
| Cat.No. : | MAZ-1319HFL | 
| Product Overview : | Recombinant Full Length Human MAZ Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Mammalian Cells | 
| Tag : | Flag | 
| Description : | Enables DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in several processes, including regulation of gene expression; regulation of signal transduction; and transcription by RNA polymerase II. Predicted to be located in cytoplasm and nucleus. | 
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
| Molecular Mass : | 48.4 kDa | 
| AA Sequence : | MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQSPFQAAPAPP PTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAASTVDTAALKQPPAPPPPPPPV SAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA IHTGAKAGRVPSGAMKMPTMVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHA CEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPD HLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV CELCNKGTGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPWTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Storage : | Store at -80 centigrade. | 
| Concentration : | >50 ug/mL as determined by microplate BCA method. | 
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Protein Families : | Transcription Factors | 
| Full Length : | Full L. | 
| Gene Name | MAZ MYC associated zinc finger protein [ Homo sapiens (human) ] | 
| Official Symbol | MAZ | 
| Synonyms | PUR1; ZF87; Pur-1; SAF-1; SAF-2; SAF-3; Zif87; ZNF801 | 
| Gene ID | 4150 | 
| mRNA Refseq | NM_002383.4 | 
| Protein Refseq | NP_002374.2 | 
| MIM | 600999 | 
| UniProt ID | P56270 | 
| ◆ Recombinant Proteins | ||
| MAZ-327H | Recombinant Human MAZ protein, GST-tagged | +Inquiry | 
| MAZ-1376H | Recombinant Human MAZ Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Maz-3976M | Recombinant Mouse Maz Protein, Myc/DDK-tagged | +Inquiry | 
| MAZ-325H | Recombinant Human MAZ protein, GST-tagged | +Inquiry | 
| MAZ-1319HFL | Recombinant Full Length Human MAZ Protein, C-Flag-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAZ Products
Required fields are marked with *
My Review for All MAZ Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            