Recombinant Full Length Human MAZ Protein, C-Flag-tagged
Cat.No. : | MAZ-1319HFL |
Product Overview : | Recombinant Full Length Human MAZ Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in several processes, including regulation of gene expression; regulation of signal transduction; and transcription by RNA polymerase II. Predicted to be located in cytoplasm and nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 48.4 kDa |
AA Sequence : | MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQSPFQAAPAPP PTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAASTVDTAALKQPPAPPPPPPPV SAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA IHTGAKAGRVPSGAMKMPTMVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHA CEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPD HLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV CELCNKGTGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | MAZ MYC associated zinc finger protein [ Homo sapiens (human) ] |
Official Symbol | MAZ |
Synonyms | PUR1; ZF87; Pur-1; SAF-1; SAF-2; SAF-3; Zif87; ZNF801 |
Gene ID | 4150 |
mRNA Refseq | NM_002383.4 |
Protein Refseq | NP_002374.2 |
MIM | 600999 |
UniProt ID | P56270 |
◆ Recombinant Proteins | ||
MAZ-327H | Recombinant Human MAZ protein, GST-tagged | +Inquiry |
MAZ-1376H | Recombinant Human MAZ Protein, His (Fc)-Avi-tagged | +Inquiry |
Maz-3976M | Recombinant Mouse Maz Protein, Myc/DDK-tagged | +Inquiry |
MAZ-325H | Recombinant Human MAZ protein, GST-tagged | +Inquiry |
MAZ-1319HFL | Recombinant Full Length Human MAZ Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAZ Products
Required fields are marked with *
My Review for All MAZ Products
Required fields are marked with *