Recombinant Full Length Human MCL1 Protein, C-Flag-tagged
Cat.No. : | MCL1-337HFL |
Product Overview : | Recombinant Full Length Human MCL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 family. Alternative splicing results in multiple transcript variants. The longest gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene products (isoform 2 and isoform 3) promote apoptosis and are death-inducing. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.2 kDa |
AA Sequence : | MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLT PDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAV LPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKAL ETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKT INQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | MCL1 MCL1 apoptosis regulator, BCL2 family member [ Homo sapiens (human) ] |
Official Symbol | MCL1 |
Synonyms | TM; EAT; MCL1L; MCL1S; Mcl-1; BCL2L3; MCL1-ES; bcl2-L-3; mcl1/EAT |
Gene ID | 4170 |
mRNA Refseq | NM_021960.5 |
Protein Refseq | NP_068779.1 |
MIM | 159552 |
UniProt ID | Q07820 |
◆ Recombinant Proteins | ||
MCL1-1381H | Recombinant Human MCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL18182CF | Recombinant Full Length Dog Induced Myeloid Leukemia Cell Differentiation Protein Mcl-1 Homolog(Mcl1) Protein, His-Tagged | +Inquiry |
Mcl1-186M | Recombinant Mouse Mcl1 protein, His-tagged | +Inquiry |
MCL1-780H | Recombinant Human MCL1 protein, His-tagged | +Inquiry |
MCL1-781H | Recombinant Human MCL1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCL1-4422HCL | Recombinant Human MCL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MCL1 Products
Required fields are marked with *
My Review for All MCL1 Products
Required fields are marked with *
0
Inquiry Basket