Recombinant Full Length Human MDM2 Protein, GST-tagged

Cat.No. : MDM2-6976HF
Product Overview : Recombinant Human full-length MDM2 (1 a.a. - 491 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 491 amino acids
Description : This gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpression or amplification of this locus is detected in a variety of different cancers. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in a multitude of transcript variants, many of which may be expressed only in tumor cells.
Molecular Mass : 81.6 kDa
AA Sequence : MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIV YCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSS HLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLD AGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCV EENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCI VHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MDM2 MDM2 oncogene, E3 ubiquitin protein ligase [ Homo sapiens (human) ]
Official Symbol MDM2
Synonyms MDM2; HDMX; hdm2; ACTFS; MDM2 oncogene, E3 ubiquitin protein ligase; E3 ubiquitin-protein ligase Mdm2; oncoprotein Mdm2; Mdm2, p53 E3 ubiquitin protein ligase homolog; double minute 2, human homolog of; p53-binding protein; Mdm2, transformed 3T3 cell double minute 2, p53 binding protein
Gene ID 4193
mRNA Refseq NM_001145337
Protein Refseq NP_001138809
MIM 164785
UniProt ID Q00987

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MDM2 Products

Required fields are marked with *

My Review for All MDM2 Products

Required fields are marked with *

0
cart-icon
0
compare icon