Recombinant Full Length Human MDM2 Protein, GST-tagged
Cat.No. : | MDM2-6976HF |
Product Overview : | Recombinant Human full-length MDM2 (1 a.a. - 491 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 491 amino acids |
Description : | This gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpression or amplification of this locus is detected in a variety of different cancers. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in a multitude of transcript variants, many of which may be expressed only in tumor cells. |
Molecular Mass : | 81.6 kDa |
AA Sequence : | MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIV YCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSS HLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLD AGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCV EENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCI VHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MDM2 MDM2 oncogene, E3 ubiquitin protein ligase [ Homo sapiens (human) ] |
Official Symbol | MDM2 |
Synonyms | MDM2; HDMX; hdm2; ACTFS; MDM2 oncogene, E3 ubiquitin protein ligase; E3 ubiquitin-protein ligase Mdm2; oncoprotein Mdm2; Mdm2, p53 E3 ubiquitin protein ligase homolog; double minute 2, human homolog of; p53-binding protein; Mdm2, transformed 3T3 cell double minute 2, p53 binding protein |
Gene ID | 4193 |
mRNA Refseq | NM_001145337 |
Protein Refseq | NP_001138809 |
MIM | 164785 |
UniProt ID | Q00987 |
◆ Recombinant Proteins | ||
MDM2-2814H | Recombinant Human MDM2 protein(31-260 aa), C-His-tagged | +Inquiry |
MDM2-4858H | Recombinant Human Mdm2 P53 Binding Protein Homolog (Mouse), GST-tagged | +Inquiry |
MDM2-651M | Recombinant Mouse MDM2 Protein (1-489 aa), His-tagged | +Inquiry |
MDM2-29756TH | Recombinant Human MDM2, His-tagged | +Inquiry |
MDM2-1064H | Recombinant Human Mdm2 p53 Binding Protein Homolog, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDM2-4404HCL | Recombinant Human MDM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MDM2 Products
Required fields are marked with *
My Review for All MDM2 Products
Required fields are marked with *