Recombinant Human MDM2 protein, T7/His-tagged
Cat.No. : | MDM2-134H |
Product Overview : | Recombinant human MDM2 cDNA (491aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDT YTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSV SENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESL ALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDED DEVYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKL ENSTQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDK EESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | MDM2 Mdm2, p53 E3 ubiquitin protein ligase homolog (mouse) [ Homo sapiens ] |
Official Symbol | MDM2 |
Synonyms | MDM2; Mdm2, p53 E3 ubiquitin protein ligase homolog (mouse); Mdm2 p53 binding protein homolog (mouse) , Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) , mouse double minute 2, human homolog of; p53 binding protein; E3 ubiquitin-protein ligase Mdm2; HDM2; HDMX; MGC5370; oncoprotein Mdm2; MDM2 variant FB28; MDM2 variant FB30; double minute 2, human homolog of; p53-binding protein; Mdm2, transformed 3T3 cell double minute 2, p53 binding protein; hdm2; ACTFS; MGC71221; |
Gene ID | 4193 |
mRNA Refseq | NM_002392 |
Protein Refseq | NP_002383 |
MIM | 164785 |
UniProt ID | Q00987 |
Chromosome Location | 12q13-q14 |
Pathway | AKT phosphorylates targets in the cytosol, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Aurora A signaling, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; |
Function | enzyme binding; ligase activity; metal ion binding; p53 binding; protein binding; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity; zinc ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
Mdm2-1771M | Recombinant Mouse Mdm2 Protein, His-tagged | +Inquiry |
MDM2-651M | Recombinant Mouse MDM2 Protein (1-489 aa), His-tagged | +Inquiry |
MDM2-2531R | Recombinant Rhesus Macaque MDM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MDM2-110H | Recombinant Human MDM2, His6-HA-SUMO-tagged | +Inquiry |
MDM2-4858H | Recombinant Human Mdm2 P53 Binding Protein Homolog (Mouse), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDM2-4404HCL | Recombinant Human MDM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MDM2 Products
Required fields are marked with *
My Review for All MDM2 Products
Required fields are marked with *
0
Inquiry Basket