Recombinant Full Length Human MFAP2 Protein, C-Flag-tagged
Cat.No. : | MFAP2-1395HFL |
Product Overview : | Recombinant Full Length Human MFAP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 18.9 kDa |
AA Sequence : | MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQV QQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRT VCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | MFAP2 microfibril associated protein 2 [ Homo sapiens (human) ] |
Official Symbol | MFAP2 |
Synonyms | MAGP; MAGP1; MAGP-1 |
Gene ID | 4237 |
mRNA Refseq | NM_017459.3 |
Protein Refseq | NP_059453.1 |
MIM | 156790 |
UniProt ID | P55001 |
◆ Recombinant Proteins | ||
Mfap2-4053M | Recombinant Mouse Mfap2 Protein, Myc/DDK-tagged | +Inquiry |
MFAP2-342H | Recombinant Human microfibrillar-associated protein 2, His-tagged | +Inquiry |
Mfap2-7948R | Recombinant Rat Mfap2 protein, His & GST-tagged | +Inquiry |
MFAP2-918H | Recombinant Human MFAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MFAP2-343H | Recombinant Human MFAP2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFAP2-4352HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
MFAP2-4351HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFAP2 Products
Required fields are marked with *
My Review for All MFAP2 Products
Required fields are marked with *