Recombinant Full Length Human MFAP2 Protein, C-Flag-tagged
| Cat.No. : | MFAP2-1395HFL |
| Product Overview : | Recombinant Full Length Human MFAP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 18.9 kDa |
| AA Sequence : | MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQV QQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRT VCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Secreted Protein |
| Full Length : | Full L. |
| Gene Name | MFAP2 microfibril associated protein 2 [ Homo sapiens (human) ] |
| Official Symbol | MFAP2 |
| Synonyms | MAGP; MAGP1; MAGP-1 |
| Gene ID | 4237 |
| mRNA Refseq | NM_017459.3 |
| Protein Refseq | NP_059453.1 |
| MIM | 156790 |
| UniProt ID | P55001 |
| ◆ Recombinant Proteins | ||
| MFAP2-1404H | Recombinant Human MFAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MFAP2-1715H | Recombinant Human MFAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MFAP2-4392H | Recombinant Human MFAP2 Protein, GST-tagged | +Inquiry |
| MFAP2-4539H | Recombinant Human MFAP2 Protein (Leu6-Val162), His tagged | +Inquiry |
| MFAP2-343H | Active Recombinant Human MFAP2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MFAP2-4351HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
| MFAP2-4352HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFAP2 Products
Required fields are marked with *
My Review for All MFAP2 Products
Required fields are marked with *



