Recombinant Full Length Human MICA Protein, GST-tagged
| Cat.No. : | MICA-6555HF |
| Product Overview : | Human MICA full-length ORF ( NP_000238.1, 1 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 383 amino acids |
| Description : | MICA encodes the higly polymorphic MHC (HLA) class I chain-related gene A. The protein product is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. [provided by RefSeq |
| Molecular Mass : | 69.3 kDa |
| AA Sequence : | MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MICA MHC class I polypeptide-related sequence A [ Homo sapiens ] |
| Official Symbol | MICA |
| Synonyms | MICA; MHC class I polypeptide-related sequence A; PERB11.1; HLA class I antigen; stress inducible class I homolog; MHC class I chain-related protein A; MIC-A; FLJ36918; FLJ60820; MGC21250; MGC111087; |
| Gene ID | 100507436 |
| mRNA Refseq | NM_000247 |
| Protein Refseq | NP_000238 |
| MIM | 600169 |
| UniProt ID | Q29983 |
| ◆ Recombinant Proteins | ||
| MICA-3970H | Recombinant Human MICA protein, His-tagged | +Inquiry |
| MICA-1232H | Recombinant Human MICA Protein, Fc-tagged | +Inquiry |
| MICA-746HFL | Recombinant Full Length Human MICA Protein, C-Flag-tagged | +Inquiry |
| MICA-0492H | Recombinant Human MICA protein, His-Avi-tagged, Biotinylated | +Inquiry |
| MICA-03H | Active Recombinant Human MICA Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MICA-1941HCL | Recombinant Human MICA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MICA Products
Required fields are marked with *
My Review for All MICA Products
Required fields are marked with *
