Recombinant Full Length Human MMP9 Protein, C-Flag-tagged
Cat.No. : | MMP9-1403HFL |
Product Overview : | Recombinant Full Length Human MMP9 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 78.3 kDa |
AA Sequence : | MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPA LLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDA FARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELW SLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRD GNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFP FTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPS AGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKW PALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGR RLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYRRVSSRSELNQVDQVGYVTYD ILQCPEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Protein Pathways : | Bladder cancer, Leukocyte transendothelial migration, Pathways in cancer |
Full Length : | Full L. |
Gene Name | MMP9 matrix metallopeptidase 9 [ Homo sapiens (human) ] |
Official Symbol | MMP9 |
Synonyms | GELB; CLG4B; MMP-9; MANDP2 |
Gene ID | 4318 |
mRNA Refseq | NM_004994.3 |
Protein Refseq | NP_004985.2 |
MIM | 120361 |
UniProt ID | P14780 |
◆ Recombinant Proteins | ||
MMP9-2451H | Recombinant Human MMP9 Protein, His-tagged | +Inquiry |
MMP9-2792C | Recombinant Cattle MMP9 protein, His & T7-tagged | +Inquiry |
Mmp9-03M | Active Recombinant Mouse Mmp9 Protein (20-730aa), C-His-tagged | +Inquiry |
MMP9-1128D | Recombinant Dog MMP9 Protein, His-tagged | +Inquiry |
MMP9-3829H | Recombinant Human MMP9, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MMP9-39H | Native Human MMP-9/Lipocalin Complex | +Inquiry |
MMP9-9810 | Active Native Human MMP9 | +Inquiry |
MMP9-40H | Native Human MMP-9/Lipocalin/TIMP-1 Complex | +Inquiry |
MMP9-30035TH | Native Human MMP9 | +Inquiry |
MMP9-41H | Native Human MMP-9/TIMP-1 Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP9-1940RCL | Recombinant Rat MMP9 cell lysate | +Inquiry |
MMP9-2026MCL | Recombinant Mouse MMP9 cell lysate | +Inquiry |
MMP9-2560HCL | Recombinant Human MMP9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP9 Products
Required fields are marked with *
My Review for All MMP9 Products
Required fields are marked with *
0
Inquiry Basket