Recombinant Human MOSPD3 Protein, GST-tagged
| Cat.No. : | MOSPD3-5489H |
| Product Overview : | Human MOSPD3 full-length ORF ( NP_076438.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding different isoforms, have been described. [provided by RefSeq |
| Molecular Mass : | 51.9 kDa |
| AA Sequence : | MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYPLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTMVFLRT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MOSPD3 motile sperm domain containing 3 [ Homo sapiens ] |
| Official Symbol | MOSPD3 |
| Synonyms | MOSPD3; motile sperm domain containing 3; motile sperm domain-containing protein 3; CDS3; NET30; |
| Gene ID | 64598 |
| mRNA Refseq | NM_001040097 |
| Protein Refseq | NP_001035186 |
| MIM | 609125 |
| UniProt ID | O75425 |
| ◆ Recombinant Proteins | ||
| MOSPD3-5489H | Recombinant Human MOSPD3 Protein, GST-tagged | +Inquiry |
| Mospd3-4120M | Recombinant Mouse Mospd3 Protein, Myc/DDK-tagged | +Inquiry |
| RFL4541MF | Recombinant Full Length Mouse Motile Sperm Domain-Containing Protein 3(Mospd3) Protein, His-Tagged | +Inquiry |
| MOSPD3-425H | Recombinant Human MOSPD3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MOSPD3-6317HF | Recombinant Full Length Human MOSPD3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MOSPD3-4243HCL | Recombinant Human MOSPD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOSPD3 Products
Required fields are marked with *
My Review for All MOSPD3 Products
Required fields are marked with *


