Recombinant Full Length Human MRNIP Protein, GST-tagged

Cat.No. : MRNIP-2674HF
Product Overview : Human MRNIP full-length ORF (AAH69051.1, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 343 amino acids
Description : MRNIP (MRN Complex Interacting Protein) is a Protein Coding gene.
Molecular Mass : 64.13 kDa
AA Sequence : MASLQRSRVLRCCSCRLFQAHQVKKSVKWTCKACGEKQSFLQAYGEGSGADCRRHVQKLNLLQGQVSELPLRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLEKDSQELELEGTGVCFSKQPSSKMEEPGPRFSQDLPRKRKWSGSTVQPPCSRGVQDSGGSEVAWGPQKGQAGLTWKVKQGSSPCLQENSADCSAGELRGPGKELWSPIQQVTATSSKWAQFVLPPRKSSHVDSEQPRSLQRDPRPAGPAQAKQGTPRAQASREGLSRPTAAVQLPRATHPVTSGSERPCGKTSWDARTPWAEGGPLVLEAQNPRPTRLCDLFITGEDFDDDV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRNIP MRN complex interacting protein [ Homo sapiens (human) ]
Official Symbol MRNIP
Synonyms MRNIP; MRN complex interacting protein; Chromosome 5 open reading frame 45; DKFZp686L2452; LOC51149; MGC65027; MGC78537; UPF0544 protein C5orf45; C5ORF45; MRN Complex Interacting Protein; MRN-Interacting Protein; C5orf45; Chromosome 5 Open Reading Frame 45; Truncated Calcium Binding Protein; MRN Complex-Interacting Protein; UPF0544 Protein C5orf45
Gene ID 51149
mRNA Refseq NM_016175
Protein Refseq NP_057259
MIM 617154
UniProt ID Q6NTE8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRNIP Products

Required fields are marked with *

My Review for All MRNIP Products

Required fields are marked with *

0
cart-icon