Recombinant Human MRNIP Protein, GST-Tagged
| Cat.No. : | MRNIP-0095H |
| Product Overview : | Human MRNIP full-length ORF (AAH69051.1, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MRNIP (MRN Complex Interacting Protein) is a Protein Coding gene. |
| Molecular Mass : | 64.13 kDa |
| AA Sequence : | MASLQRSRVLRCCSCRLFQAHQVKKSVKWTCKACGEKQSFLQAYGEGSGADCRRHVQKLNLLQGQVSELPLRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLEKDSQELELEGTGVCFSKQPSSKMEEPGPRFSQDLPRKRKWSGSTVQPPCSRGVQDSGGSEVAWGPQKGQAGLTWKVKQGSSPCLQENSADCSAGELRGPGKELWSPIQQVTATSSKWAQFVLPPRKSSHVDSEQPRSLQRDPRPAGPAQAKQGTPRAQASREGLSRPTAAVQLPRATHPVTSGSERPCGKTSWDARTPWAEGGPLVLEAQNPRPTRLCDLFITGEDFDDDV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MRNIP MRN complex interacting protein [ Homo sapiens (human) ] |
| Official Symbol | MRNIP |
| Synonyms | MRNIP; MRN complex interacting protein; Chromosome 5 open reading frame 45; DKFZp686L2452; LOC51149; MGC65027; MGC78537; UPF0544 protein C5orf45; C5ORF45; MRN Complex Interacting Protein; MRN-Interacting Protein; C5orf45; Chromosome 5 Open Reading Frame 45; Truncated Calcium Binding Protein; MRN Complex-Interacting Protein; UPF0544 Protein C5orf45 |
| Gene ID | 51149 |
| mRNA Refseq | NM_016175 |
| Protein Refseq | NP_057259 |
| MIM | 617154 |
| UniProt ID | Q6NTE8 |
| ◆ Recombinant Proteins | ||
| Mrnip-4144M | Recombinant Mouse Mrnip Protein, Myc/DDK-tagged | +Inquiry |
| MRNIP-0095H | Recombinant Human MRNIP Protein, GST-Tagged | +Inquiry |
| MRNIP-4642H | Recombinant Human MRNIP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MRNIP-2674HF | Recombinant Full Length Human MRNIP Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRNIP Products
Required fields are marked with *
My Review for All MRNIP Products
Required fields are marked with *
