Recombinant Full Length Human MRPL22 Protein, GST-tagged
| Cat.No. : | MRPL22-6414HF |
| Product Overview : | Human MRPL22 full-length ORF ( AAH12565, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 206 amino acids |
| Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L22 ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 4q. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 48.40 kDa |
| AA Sequence : | MAAAVLGQLGALWIHNLRSRGKLALGVLPQSYIHTSASLDISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKECIQQLRSRTIVHTL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MRPL22 mitochondrial ribosomal protein L22 [ Homo sapiens ] |
| Official Symbol | MRPL22 |
| Synonyms | MRPL22; mitochondrial ribosomal protein L22; 39S ribosomal protein L22, mitochondrial; HSPC158; MRP L25; RPML25; L25mt; 39S ribosomal protein L25, mitochondrial; L22mt; MRP-L22; MRP-L25; DKFZp781F1071; |
| Gene ID | 29093 |
| mRNA Refseq | NM_001014990 |
| Protein Refseq | NP_001014990 |
| MIM | 611835 |
| UniProt ID | Q9NWU5 |
| ◆ Recombinant Proteins | ||
| MRPL22-145H | Recombinant Human MRPL22, His-tagged | +Inquiry |
| MRPL22-2659R | Recombinant Rhesus Macaque MRPL22 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MRPL22-990H | Recombinant Human MRPL22, His-tagged | +Inquiry |
| MRPL22-3426R | Recombinant Rat MRPL22 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MRPL22-2839R | Recombinant Rhesus monkey MRPL22 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRPL22-4187HCL | Recombinant Human MRPL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL22 Products
Required fields are marked with *
My Review for All MRPL22 Products
Required fields are marked with *
