Recombinant Full Length Human MSTO1 Protein, GST-tagged
| Cat.No. : | MSTO1-6475HF |
| Product Overview : | Human MSTO1 full-length ORF ( NP_060586.2, 1 a.a. - 570 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 570 amino acids |
| Description : | MSTO1 (Misato 1, Mitochondrial Distribution And Morphology Regulator) is a Protein Coding gene. GO annotations related to this gene include GTPase activity. |
| Molecular Mass : | 88.2 kDa |
| AA Sequence : | MAGGAREVLTLQLGHFAGFVGAHWWNQQDAALGRATDSKEPPGELCPDVLYRTGRTLHGQETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKAAELLQDEYSGRGIITWGLLPGPYHRGEAQRNIYRLLNTAFGLVHLTAHSSLVCPLSLGGSLGLRPEPPVSFPYLHYDATLPFHCSAILATALDTVTVPYRLCSSPVSMVHLADMLSFCGKKVVTAGAIIPFPLAPGQSLPDSLMQFGGATPWTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTPGTPPPSALHACTTGEEILAQYLQQQQPGVMSSSHLLLTPCRVAPPYPHLFSSCSPPGMVLDGSPKGAAVESIPVFGALCSSSSLHQTLEALARDLTKLDLRRWASFMDAGVEHDDVAELLQELQSLAQCYQGGDSLVD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MSTO1 misato homolog 1 (Drosophila) [ Homo sapiens ] |
| Official Symbol | MSTO1 |
| Synonyms | MSTO1; misato homolog 1 (Drosophila); protein misato homolog 1; FLJ10504; LST005; MST; DKFZp686B1757; DKFZp686I01261; |
| Gene ID | 55154 |
| mRNA Refseq | NM_001256532 |
| Protein Refseq | NP_001243461 |
| MIM | 617619 |
| UniProt ID | Q9BUK6 |
| ◆ Recombinant Proteins | ||
| MSTO1-3962H | Recombinant Human MSTO1 protein, His-tagged | +Inquiry |
| MSTO1-5675H | Recombinant Human MSTO1 Protein, GST-tagged | +Inquiry |
| MSTO1-10259Z | Recombinant Zebrafish MSTO1 | +Inquiry |
| Msto1-1591M | Recombinant Mouse Msto1 protein, His & T7-tagged | +Inquiry |
| MSTO1-6475HF | Recombinant Full Length Human MSTO1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MSTO1-1140HCL | Recombinant Human MSTO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSTO1 Products
Required fields are marked with *
My Review for All MSTO1 Products
Required fields are marked with *




