Recombinant Human MSTO1 Protein, GST-tagged
Cat.No. : | MSTO1-5675H |
Product Overview : | Human MSTO1 full-length ORF ( NP_060586.2, 1 a.a. - 570 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MSTO1 (Misato 1, Mitochondrial Distribution And Morphology Regulator) is a Protein Coding gene. GO annotations related to this gene include GTPase activity. |
Molecular Mass : | 88.2 kDa |
AA Sequence : | MAGGAREVLTLQLGHFAGFVGAHWWNQQDAALGRATDSKEPPGELCPDVLYRTGRTLHGQETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKAAELLQDEYSGRGIITWGLLPGPYHRGEAQRNIYRLLNTAFGLVHLTAHSSLVCPLSLGGSLGLRPEPPVSFPYLHYDATLPFHCSAILATALDTVTVPYRLCSSPVSMVHLADMLSFCGKKVVTAGAIIPFPLAPGQSLPDSLMQFGGATPWTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTPGTPPPSALHACTTGEEILAQYLQQQQPGVMSSSHLLLTPCRVAPPYPHLFSSCSPPGMVLDGSPKGAAVESIPVFGALCSSSSLHQTLEALARDLTKLDLRRWASFMDAGVEHDDVAELLQELQSLAQCYQGGDSLVD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MSTO1 misato homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | MSTO1 |
Synonyms | MSTO1; misato homolog 1 (Drosophila); protein misato homolog 1; FLJ10504; LST005; MST; DKFZp686B1757; DKFZp686I01261; |
Gene ID | 55154 |
mRNA Refseq | NM_001256532 |
Protein Refseq | NP_001243461 |
UniProt ID | Q9BUK6 |
◆ Recombinant Proteins | ||
MSTO1-6475HF | Recombinant Full Length Human MSTO1 Protein, GST-tagged | +Inquiry |
MSTO1-5675H | Recombinant Human MSTO1 Protein, GST-tagged | +Inquiry |
Msto1-1591M | Recombinant Mouse Msto1 protein, His & T7-tagged | +Inquiry |
MSTO1-3962H | Recombinant Human MSTO1 protein, His-tagged | +Inquiry |
MSTO1-10259Z | Recombinant Zebrafish MSTO1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSTO1-1140HCL | Recombinant Human MSTO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSTO1 Products
Required fields are marked with *
My Review for All MSTO1 Products
Required fields are marked with *
0
Inquiry Basket