Recombinant Human MSTO1 protein, His-tagged
Cat.No. : | MSTO1-3962H |
Product Overview : | Recombinant Human MSTO1 protein(28-256 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 28-256 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QDAALGRATDSKEPPGELCPDVLYRTGRTLHGQETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKAAELLQDEYSGR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MSTO1 misato homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | MSTO1 |
Synonyms | MSTO1; misato homolog 1 (Drosophila); protein misato homolog 1; FLJ10504; LST005; MST; DKFZp686B1757; DKFZp686I01261; |
Gene ID | 55154 |
mRNA Refseq | NM_001256532 |
Protein Refseq | NP_001243461 |
UniProt ID | Q9BUK6 |
◆ Recombinant Proteins | ||
MSTO1-10259Z | Recombinant Zebrafish MSTO1 | +Inquiry |
Msto1-1591M | Recombinant Mouse Msto1 protein, His & T7-tagged | +Inquiry |
MSTO1-6475HF | Recombinant Full Length Human MSTO1 Protein, GST-tagged | +Inquiry |
MSTO1-3962H | Recombinant Human MSTO1 protein, His-tagged | +Inquiry |
MSTO1-5675H | Recombinant Human MSTO1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSTO1-1140HCL | Recombinant Human MSTO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSTO1 Products
Required fields are marked with *
My Review for All MSTO1 Products
Required fields are marked with *