Recombinant Human MSTO1 protein, His-tagged
| Cat.No. : | MSTO1-3962H |
| Product Overview : | Recombinant Human MSTO1 protein(28-256 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 28-256 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | QDAALGRATDSKEPPGELCPDVLYRTGRTLHGQETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKAAELLQDEYSGR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | MSTO1 misato homolog 1 (Drosophila) [ Homo sapiens ] |
| Official Symbol | MSTO1 |
| Synonyms | MSTO1; misato homolog 1 (Drosophila); protein misato homolog 1; FLJ10504; LST005; MST; DKFZp686B1757; DKFZp686I01261; |
| Gene ID | 55154 |
| mRNA Refseq | NM_001256532 |
| Protein Refseq | NP_001243461 |
| UniProt ID | Q9BUK6 |
| ◆ Recombinant Proteins | ||
| MSTO1-10259Z | Recombinant Zebrafish MSTO1 | +Inquiry |
| MSTO1-3962H | Recombinant Human MSTO1 protein, His-tagged | +Inquiry |
| MSTO1-5675H | Recombinant Human MSTO1 Protein, GST-tagged | +Inquiry |
| MSTO1-6475HF | Recombinant Full Length Human MSTO1 Protein, GST-tagged | +Inquiry |
| Msto1-1591M | Recombinant Mouse Msto1 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MSTO1-1140HCL | Recombinant Human MSTO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSTO1 Products
Required fields are marked with *
My Review for All MSTO1 Products
Required fields are marked with *
