Recombinant Full Length Human MYOT Protein, GST-tagged
| Cat.No. : | MYOT-6616HF |
| Product Overview : | Human MYOT full-length ORF ( NP_006781.1, 1 a.a. - 498 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 498 amino acids |
| Description : | This gene encodes a cystoskeletal protein which plays a significant role in the stability of thin filaments during muscle contraction. This protein binds F-actin, crosslinks actin filaments, and prevents latrunculin A-induced filament disassembly. Mutations in this gene have been associated with limb-girdle muscular dystrophy and myofibrillar myopathies. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined |
| Molecular Mass : | 81.8 kDa |
| AA Sequence : | MFNYERPKHFIQSQNPCGSRLQPPGPETSSFSSQTKQSSIIIQPRQCTEQRFSASSTLSSHITMSSSAFPASPQQHAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNYQQSSAGQPINAKPSQTANAKPIPRTPDHEIQGSKEALIQDLERKLKCKDTLLHNGNQRLTYEEKMARRLLGPQNAAAVFQAQDDSGAQDSQQHNSEHARLQVPTSQVRSRSTSRGDVNDQDAIQEKFYPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYOT myotilin [ Homo sapiens ] |
| Official Symbol | MYOT |
| Synonyms | MYOT; myotilin; LGMD1, LGMD1A, limb girdle muscular dystrophy 1A (autosomal dominant) , titin immunoglobulin domain protein (myotilin) , TTID; 57 kDa cytoskeletal protein; myofibrillar titin-like Ig domains protein; titin immunoglobulin domain protein (myotilin); TTID; LGMD1; LGMD1A; |
| Gene ID | 9499 |
| mRNA Refseq | NM_001135940 |
| Protein Refseq | NP_001129412 |
| MIM | 604103 |
| UniProt ID | Q9UBF9 |
| ◆ Recombinant Proteins | ||
| MYOT-556H | Recombinant Human MYOT protein, GST-tagged | +Inquiry |
| MYOT-6616HF | Recombinant Full Length Human MYOT Protein, GST-tagged | +Inquiry |
| Myot-1811M | Recombinant Mouse Myot Protein, His-tagged | +Inquiry |
| MYOT-2496H | Recombinant Human MYOT Protein, His-tagged | +Inquiry |
| MYOT-5856H | Recombinant Human MYOT Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYOT-4003HCL | Recombinant Human MYOT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOT Products
Required fields are marked with *
My Review for All MYOT Products
Required fields are marked with *




