Recombinant Human MYOT protein, GST-tagged
Cat.No. : | MYOT-556H |
Product Overview : | Recombinant Human MYOT protein(NP_001129412)(191-498 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 191-498 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | GPQNAAAVFQAQDDSGAQDSQQHNSEHARLQVPTSQVRSRSTSRGDVNDQDAIQEKFYPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MYOT myotilin [ Homo sapiens ] |
Official Symbol | MYOT |
Synonyms | MYOT; myotilin; LGMD1, LGMD1A, limb girdle muscular dystrophy 1A (autosomal dominant) , titin immunoglobulin domain protein (myotilin) , TTID; 57 kDa cytoskeletal protein; myofibrillar titin-like Ig domains protein; titin immunoglobulin domain protein (myotilin); TTID; LGMD1; LGMD1A; |
Gene ID | 9499 |
mRNA Refseq | NM_001135940 |
Protein Refseq | NP_001129412 |
MIM | 604103 |
UniProt ID | Q9UBF9 |
◆ Recombinant Proteins | ||
MYOT-2496H | Recombinant Human MYOT Protein, His-tagged | +Inquiry |
MYOT-5856H | Recombinant Human MYOT Protein, GST-tagged | +Inquiry |
Myot-1811M | Recombinant Mouse Myot Protein, His-tagged | +Inquiry |
MYOT-6616HF | Recombinant Full Length Human MYOT Protein, GST-tagged | +Inquiry |
MYOT-556H | Recombinant Human MYOT protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYOT-4003HCL | Recombinant Human MYOT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYOT Products
Required fields are marked with *
My Review for All MYOT Products
Required fields are marked with *
0
Inquiry Basket