Recombinant Full Length Human NIPSNAP3A Protein, C-Flag-tagged
| Cat.No. : | NIPSNAP3A-1404HFL |
| Product Overview : | Recombinant Full Length Human NIPSNAP3A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | NIPSNAP3A belongs to a family of proteins with putative roles in vesicular transport. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 28.3 kDa |
| AA Sequence : | MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELV GYWSVEFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKP PKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGR HKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | NIPSNAP3A nipsnap homolog 3A [ Homo sapiens (human) ] |
| Official Symbol | NIPSNAP3A |
| Synonyms | TASSC; HSPC299; NIPSNAP4 |
| Gene ID | 25934 |
| mRNA Refseq | NM_015469.3 |
| Protein Refseq | NP_056284.1 |
| MIM | 608871 |
| UniProt ID | Q9UFN0 |
| ◆ Recombinant Proteins | ||
| NIPSNAP3A-10602Z | Recombinant Zebrafish NIPSNAP3A | +Inquiry |
| NIPSNAP3A-5877H | Recombinant Human NIPSNAP3A Protein, His-tagged | +Inquiry |
| NIPSNAP3A-5876H | Recombinant Human NIPSNAP3A Protein, GST-tagged | +Inquiry |
| NIPSNAP3A-1512H | Recombinant Human NIPSNAP3A Protein, His (Fc)-Avi-tagged | +Inquiry |
| NIPSNAP3A-1404HFL | Recombinant Full Length Human NIPSNAP3A Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NIPSNAP3A-3826HCL | Recombinant Human NIPSNAP3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NIPSNAP3A Products
Required fields are marked with *
My Review for All NIPSNAP3A Products
Required fields are marked with *
