Recombinant Human NIPSNAP3A Protein, GST-tagged

Cat.No. : NIPSNAP3A-5876H
Product Overview : Human NIPSNAP3A full-length ORF ( NP_056284.1, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NIPSNAP3A belongs to a family of proteins with putative roles in vesicular transport (Buechler et al., 2004 [PubMed 15177564]).[supplied by OMIM
Molecular Mass : 54.9 kDa
AA Sequence : MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELVGYWSVEFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKPPKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NIPSNAP3A nipsnap homolog 3A (C. elegans) [ Homo sapiens ]
Official Symbol NIPSNAP3A
Synonyms NIPSNAP3A; nipsnap homolog 3A (C. elegans); protein NipSnap homolog 3A; DKFZp564D177; FLJ13953; HSPC299; MGC14553; protein NipSnap homolog 4; target for Salmonella secreted protein C; TASSC; NIPSNAP4;
Gene ID 25934
mRNA Refseq NM_015469
Protein Refseq NP_056284
MIM 608871
UniProt ID Q9UFN0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NIPSNAP3A Products

Required fields are marked with *

My Review for All NIPSNAP3A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon