Recombinant Human NIPSNAP3A Protein, GST-tagged
| Cat.No. : | NIPSNAP3A-5876H |
| Product Overview : | Human NIPSNAP3A full-length ORF ( NP_056284.1, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | NIPSNAP3A belongs to a family of proteins with putative roles in vesicular transport (Buechler et al., 2004 [PubMed 15177564]).[supplied by OMIM |
| Molecular Mass : | 54.9 kDa |
| AA Sequence : | MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELVGYWSVEFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKPPKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NIPSNAP3A nipsnap homolog 3A (C. elegans) [ Homo sapiens ] |
| Official Symbol | NIPSNAP3A |
| Synonyms | NIPSNAP3A; nipsnap homolog 3A (C. elegans); protein NipSnap homolog 3A; DKFZp564D177; FLJ13953; HSPC299; MGC14553; protein NipSnap homolog 4; target for Salmonella secreted protein C; TASSC; NIPSNAP4; |
| Gene ID | 25934 |
| mRNA Refseq | NM_015469 |
| Protein Refseq | NP_056284 |
| MIM | 608871 |
| UniProt ID | Q9UFN0 |
| ◆ Recombinant Proteins | ||
| NIPSNAP3A-6637HF | Recombinant Full Length Human NIPSNAP3A Protein, GST-tagged | +Inquiry |
| NIPSNAP3A-1404HFL | Recombinant Full Length Human NIPSNAP3A Protein, C-Flag-tagged | +Inquiry |
| NIPSNAP3A-2422H | Recombinant Human NIPSNAP3A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NIPSNAP3A-5877H | Recombinant Human NIPSNAP3A Protein, His-tagged | +Inquiry |
| NIPSNAP3A-10602Z | Recombinant Zebrafish NIPSNAP3A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NIPSNAP3A-3826HCL | Recombinant Human NIPSNAP3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NIPSNAP3A Products
Required fields are marked with *
My Review for All NIPSNAP3A Products
Required fields are marked with *
