Recombinant Human NIPSNAP3A Protein, His-tagged
Cat.No. : | NIPSNAP3A-5877H |
Product Overview : | Recombinant Human NIPSNAP3A Protein(1-247 aa)(NP_001316499), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-247 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELVGYWSVEFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKPPKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NIPSNAP3A nipsnap homolog 3A [ Homo sapiens (human) ] |
Official Symbol | NIPSNAP3A |
Synonyms | TASSC; HSPC299; NIPSNAP4 |
Gene ID | 25934 |
mRNA Refseq | NM_001329570 |
Protein Refseq | NP_001316499 |
MIM | 608871 |
UniProt ID | Q9UFN0 |
◆ Recombinant Proteins | ||
NIPSNAP3A-5876H | Recombinant Human NIPSNAP3A Protein, GST-tagged | +Inquiry |
NIPSNAP3A-1404HFL | Recombinant Full Length Human NIPSNAP3A Protein, C-Flag-tagged | +Inquiry |
NIPSNAP3A-6637HF | Recombinant Full Length Human NIPSNAP3A Protein, GST-tagged | +Inquiry |
NIPSNAP3A-2422H | Recombinant Human NIPSNAP3A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NIPSNAP3A-5877H | Recombinant Human NIPSNAP3A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NIPSNAP3A-3826HCL | Recombinant Human NIPSNAP3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NIPSNAP3A Products
Required fields are marked with *
My Review for All NIPSNAP3A Products
Required fields are marked with *
0
Inquiry Basket