Recombinant Full Length Human Oxidized Low-Density Lipoprotein Receptor 1(Olr1) Protein, His-Tagged
| Cat.No. : | RFL27553HF |
| Product Overview : | Recombinant Full Length Human Oxidized low-density lipoprotein receptor 1(OLR1) Protein (P78380) (1-273aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-273) |
| Form : | Lyophilized powder |
| AA Sequence : | MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | OLR1 |
| Synonyms | C-type lectin domain family 8 member A; CLEC8A; hLOX 1; hLOX-1; Lectin like oxidized LDL receptor 1; Lectin like oxLDL receptor 1; Lectin type oxidized LDL receptor 1; Lectin-like oxidized LDL receptor 1; Lectin-like oxLDL receptor 1; Lectin-type oxidized |
| UniProt ID | P78380 |
| ◆ Recombinant Proteins | ||
| OLR1-12146M | Recombinant Mouse OLR1 protein, His-tagged | +Inquiry |
| OLR1-693HFL | Active Recombinant Full Length Human OLR1 Protein, C-Flag-tagged | +Inquiry |
| OLR1-3166R | Recombinant Rhesus monkey OLR1 Protein, His-tagged | +Inquiry |
| Olr1-1886M | Recombinant Mouse Olr1 protein, His & T7-tagged | +Inquiry |
| OLR1-2808H | Recombinant Human OLR1 protein(61-150 aa), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OLR1-1170CCL | Recombinant Cynomolgus OLR1 cell lysate | +Inquiry |
| OLR1-1716HCL | Recombinant Human OLR1 cell lysate | +Inquiry |
| OLR1-001RCL | Recombinant Rat OLR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OLR1 Products
Required fields are marked with *
My Review for All OLR1 Products
Required fields are marked with *



