Recombinant Full Length Human PARK2 Protein
Cat.No. : | PARK2-356HF |
Product Overview : | Recombinant full length Human Parkin with N terminal proprietary tag; Predicted MWt 68.64 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 387 amino acids |
Description : | The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support. |
Form : | Liquid |
Molecular Mass : | 68.640kDa inclusive of tags |
AA Sequence : | MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQ LRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQ EMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVG LAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQR VQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGEC QSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSR NITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLND RQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGC PNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCP RPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PARK2 parkinson protein 2, E3 ubiquitin protein ligase (parkin) [ Homo sapiens ] |
Official Symbol | PARK2 |
Synonyms | PARK2; parkinson protein 2, E3 ubiquitin protein ligase (parkin); Parkinson disease (autosomal recessive, juvenile) 2, parkin; E3 ubiquitin-protein ligase parkin; AR JP; E3 ubiquitin ligase; parkin; PDJ |
Gene ID | 5071 |
mRNA Refseq | NM_004562 |
Protein Refseq | NP_004553 |
MIM | 602544 |
UniProt ID | O60260 |
◆ Recombinant Proteins | ||
PARK2-5021H | Recombinant Human PARK2, His-tagged | +Inquiry |
PARK2-6497M | Recombinant Mouse PARK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Park2-4799R | Recombinant Rat Park2 protein, His&Myc-tagged | +Inquiry |
PARK2-356HF | Recombinant Full Length Human PARK2 Protein | +Inquiry |
PARK2-12362M | Recombinant Mouse PARK2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PARK2-3433HCL | Recombinant Human PARK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PARK2 Products
Required fields are marked with *
My Review for All PARK2 Products
Required fields are marked with *