Recombinant Full Length Human PAXX Protein, GST-tagged

Cat.No. : PAXX-3907HF
Product Overview : Human C9orf142 full-length ORF ( NP_899064.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 204 amino acids
Description : The protein encoded by this gene plays a role in the nonhomologous end joining (NHEJ) pathway of DNA double-strand break repair. The encoded protein may function to stabilize the Ku70/Ku80 heterodimer to facilitate the assembly and maintain the stability of the NHEJ complex. [provided by RefSeq, Jul 2016]
Molecular Mass : 48 kDa
AA Sequence : MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAALKARFGLSAAEDITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PAXX PAXX, non-homologous end joining factor [ Homo sapiens (human) ]
Official Symbol PAXX
Synonyms C9orf142; PAXX; PAXX, non-homologous end joining factor; XLS; C9orf142; protein PAXX; XRCC4-like small protein; paralog of XRCC4 and XLF\
Gene ID 286257
mRNA Refseq NM_001329678
Protein Refseq NP_001316607
MIM 616315
UniProt ID Q9BUH6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAXX Products

Required fields are marked with *

My Review for All PAXX Products

Required fields are marked with *

0
cart-icon
0
compare icon