Recombinant Human PAXX Protein, GST-tagged

• Cat.No.: PAXX-5248H
• Product Overview: Human C9orf142 full-length ORF ( NP_899064.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene plays a role in the nonhomologous end joining (NHEJ) pathway of DNA double-strand break repair. The encoded protein may function to stabilize the Ku70/Ku80 heterodimer to facilitate the assembly and maintain the stability of the NHEJ complex. [provided by RefSeq, Jul 2016]
• Molecular Mass: 48 kDa
• AA Sequence: MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAALKARFGLSAAEDITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PAXX PAXX, non-homologous end joining factor [ Homo sapiens (human) ]
• Official Symbol: PAXX
• Synonyms: C9orf142; PAXX; PAXX, non-homologous end joining factor; XLS; C9orf142; protein PAXX; XRCC4-like small protein; paralog of XRCC4 and XLF\
• Gene ID: 286257
• mRNA Refseq: NM_001329678
• Protein Refseq: NP_001316607
• MIM: 616315
• UniProt ID: Q9BUH6