Recombinant Human PAXX Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PAXX-2730H
• Product Overview: C9orf142 MS Standard C13 and N15-labeled recombinant protein (NP_899064) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene plays a role in the nonhomologous end joining (NHEJ) pathway of DNA double-strand break repair. The encoded protein may function to stabilize the Ku70/Ku80 heterodimer to facilitate the assembly and maintain the stability of the NHEJ complex.
• Molecular Mass: 21.6 kDa
• AA Sequence: MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAALKARFGLSAAEDITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDETSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PAXX PAXX non-homologous end joining factor [ Homo sapiens (human) ]
• Official Symbol: PAXX
• Synonyms: PAXX; PAXX non-homologous end joining factor; XLS; C9orf142; protein PAXX; XRCC4-like small protein; paralog of XRCC4 and XLF
• Gene ID: 286257
• mRNA Refseq: NM_183241
• Protein Refseq: NP_899064
• MIM: 616315
• UniProt ID: Q9BUH6