Recombinant Full Length Human PBX homeobox 1 Protein, Flag tagged
Cat.No. : | PBX1-14HFL |
Product Overview : | Recombinant protein of human pre-B-cell leukemia homeobox 1 (PBX1) with C-Flag tag was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Protein Length : | 1-430 aa |
Description : | This gene encodes a nuclear protein that belongs to the PBX homeobox family of transcriptional factors. Studies in mice suggest that this gene may be involved in the regulation of osteogenesis and required for skeletal patterning and programming. A chromosomal translocation, t(1;19) involving this gene and TCF3/E2A gene, is associated with pre-B-cell acute lymphoblastic leukemia. The resulting fusion protein, in which the DNA binding domain of E2A is replaced by the DNA binding domain of this protein, transforms cells by constitutively activating transcription of genes regulated by the PBX protein family. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Tag : | C-Flag |
Molecular Mass : | 46.4 kDa |
AA Sequence : | MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEGPGSVHSDTSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Concentration : | > 0.05 μg/μL as determined by microplate BCA method |
Gene Name | PBX1 PBX homeobox 1 [ Homo sapiens (human) ] |
Official Symbol | PBX1 |
Synonyms | PBX1; PBX homeobox 1; CAKUHED; pre-B-cell leukemia transcription factor 1; homeobox protein PBX1; homeobox protein PRL; pre-B-cell leukemia homeobox 1 |
Gene ID | 5087 |
mRNA Refseq | NM_002585 |
Protein Refseq | NP_002576 |
MIM | 176310 |
UniProt ID | P40424 |
◆ Recombinant Proteins | ||
Pbx1-4692M | Recombinant Mouse Pbx1 Protein, Myc/DDK-tagged | +Inquiry |
PBX1-2499H | Recombinant Human PBX1 protein, GST-tagged | +Inquiry |
PBX1-6311C | Recombinant Chicken PBX1 | +Inquiry |
PBX1-12406M | Recombinant Mouse PBX1 Protein | +Inquiry |
PBX1-2878H | Recombinant Human PBX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PBX1-3408HCL | Recombinant Human PBX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PBX1 Products
Required fields are marked with *
My Review for All PBX1 Products
Required fields are marked with *
0
Inquiry Basket