Recombinant Full Length Human PBX homeobox 1 Protein, Flag tagged

Cat.No. : PBX1-14HFL
Product Overview : Recombinant protein of human pre-B-cell leukemia homeobox 1 (PBX1) with C-Flag tag was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag
Protein Length : 1-430 aa
Description : This gene encodes a nuclear protein that belongs to the PBX homeobox family of transcriptional factors. Studies in mice suggest that this gene may be involved in the regulation of osteogenesis and required for skeletal patterning and programming. A chromosomal translocation, t(1;19) involving this gene and TCF3/E2A gene, is associated with pre-B-cell acute lymphoblastic leukemia. The resulting fusion protein, in which the DNA binding domain of E2A is replaced by the DNA binding domain of this protein, transforms cells by constitutively activating transcription of genes regulated by the PBX protein family. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Tag : C-Flag
Molecular Mass : 46.4 kDa
AA Sequence : MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEGPGSVHSDTSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Storage Buffer : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Concentration : > 0.05 μg/μL as determined by microplate BCA method
Gene Name PBX1 PBX homeobox 1 [ Homo sapiens (human) ]
Official Symbol PBX1
Synonyms PBX1; PBX homeobox 1; CAKUHED; pre-B-cell leukemia transcription factor 1; homeobox protein PBX1; homeobox protein PRL; pre-B-cell leukemia homeobox 1
Gene ID 5087
mRNA Refseq NM_002585
Protein Refseq NP_002576
MIM 176310
UniProt ID P40424

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PBX1 Products

Required fields are marked with *

My Review for All PBX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon