Recombinant Human PBX1 protein, His-tagged
| Cat.No. : | PBX1-2498H |
| Product Overview : | Recombinant Human PBX1 protein(1-349 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 25, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-349 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PBX1 pre-B-cell leukemia homeobox 1 [ Homo sapiens ] |
| Official Symbol | PBX1 |
| Synonyms | PBX1; pre-B-cell leukemia homeobox 1; pre B cell leukemia transcription factor 1; pre-B-cell leukemia transcription factor 1; homeobox protein PRL; homeobox protein PBX1; MGC126627; DKFZp686B09108; |
| Gene ID | 5087 |
| mRNA Refseq | NM_001204961 |
| Protein Refseq | NP_001191890 |
| MIM | 176310 |
| UniProt ID | P40424 |
| ◆ Recombinant Proteins | ||
| PBX1-14HFL | Recombinant Full Length Human PBX homeobox 1 Protein, Flag tagged | +Inquiry |
| Pbx1-4692M | Recombinant Mouse Pbx1 Protein, Myc/DDK-tagged | +Inquiry |
| PBX1-13HFL | Recombinant Full Length Human PBX homeobox 1 Protein, His&T7 tagged | +Inquiry |
| PBX1-2498H | Recombinant Human PBX1 protein, His-tagged | +Inquiry |
| PBX1-2499H | Recombinant Human PBX1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PBX1-3408HCL | Recombinant Human PBX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PBX1 Products
Required fields are marked with *
My Review for All PBX1 Products
Required fields are marked with *
