Recombinant Full Length Human PDCD6 Protein, C-Flag-tagged
Cat.No. : | PDCD6-1650HFL |
Product Overview : | Recombinant Full Length Human PDCD6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T cell receptor-, Fas-, and glucocorticoid-induced programmed cell death. In mice deficient for this gene product, however, apoptosis was not blocked suggesting this gene product is functionally redundant. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is also located on the short arm of chromosome 5. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIIS MFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDR QGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | PDCD6 programmed cell death 6 [ Homo sapiens (human) ] |
Official Symbol | PDCD6 |
Synonyms | ALG2; ALG-2; PEF1B |
Gene ID | 10016 |
mRNA Refseq | NM_013232.4 |
Protein Refseq | NP_037364.1 |
MIM | 601057 |
UniProt ID | O75340 |
◆ Recombinant Proteins | ||
PDCD6-2556H | Recombinant Human PDCD6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDCD6-1650HFL | Recombinant Full Length Human PDCD6 Protein, C-Flag-tagged | +Inquiry |
PDCD6-12537M | Recombinant Mouse PDCD6 Protein | +Inquiry |
PDCD6-1825R | Recombinant Rhesus Monkey PDCD6 Protein, hIgG4-tagged | +Inquiry |
PDCD6-3427H | Recombinant Human PDCD6 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDCD6-3359HCL | Recombinant Human PDCD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDCD6 Products
Required fields are marked with *
My Review for All PDCD6 Products
Required fields are marked with *
0
Inquiry Basket