Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Full Length Human PDE4A Protein

Cat.No. : PDE4A-366HF
Product Overview : Recombinant full length Human PDE4A, isoform 4 with N terminal proprietary tag. Predicted MW 97.24 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 97.240kDa inclusive of tags
Protein Length : 647 amino acids
AA Sequence : MPLVDFFCETCSKPWLVGWWDQFKRMLNRELTHLSEMSRS GNQVSEYISTTFLDKQNEVEIPSPTMKEREKQQAPRPRPS QPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKT DQEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIF QERDLLKKFRIPVDTMVTYMLTLEDHYHADVAYHNSLHAA DVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPG VSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNC DIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTM VETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPL ELYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVE KSQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNRDWY YSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEE EISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQE SLEVMAQEASLEAELEAVYLTQQAQSTGSAPVAPDEFSSR EEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGL PSTAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGG GSGGDPT
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Gene Name : PDE4A phosphodiesterase 4A, cAMP-specific [ Homo sapiens ]
Official Symbol : PDE4A
Synonyms : PDE4A; phosphodiesterase 4A, cAMP-specific; DPDE2, phosphodiesterase 4A, cAMP specific (dunce (Drosophila) homolog phosphodiesterase E2); cAMP-specific 3,5-cyclic phosphodiesterase 4A; phosphodiesterase E2 dunce homolog (Drosophila)
Gene ID : 5141
mRNA Refseq : NM_001111307
Protein Refseq : NP_001104777
MIM : 600126
UniProt ID : P27815

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
How effective are PDE4A inhibitors in the treatment of asthma? 04/12/2022

The inhibitors have been used in the treatment of asthma, and studies have shown that they can significantly reduce the number of asthma attacks and the use of drug D.

How to introduce the structure of PDE4A? 03/30/2022

This protein has multiple conserved regions and different subtypes, which is of great significance for the selective inhibition of drugs.

What is a selective PDE4A inhibitor? 12/25/2021

Selective PDE4A inhibitors refer to drug molecules that target only the PDE4A protein and do not inhibit other PDE4 homologs.

What is the mechanism by which PDE4A regulates T cell-mediated autoimmune responses? 05/30/2021

It plays an important role in the activation and regulation of T cells by regulating cAMP levels, and is involved in T cell-mediated autoimmune responses.

Are levels of PDE4A associated with sleep disturbances? 02/12/2021

Studies have shown that PDE4A depletion may be related to sleep-wake behavior and time stress response, but its specific role needs to be further studied.

What is the expression pattern of PDE4A in T cells? 08/27/2020

In T cells, PDE4A is mainly expressed in the cytoplasm and peripheral regions of the nuclear membrane.

Customer Reviews (3)

Write a review
Reviews
12/05/2022

    PDE4A requires less storage environment.

    07/26/2022

      The expression of PDE4A was stable.

      02/08/2022

        It has the advantage of easy operation in the expression system and can improve the expression efficiency.

        Ask a Question for All PDE4A Products

        Required fields are marked with *

        My Review for All PDE4A Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends