Recombinant Full Length Human PDE4A Protein
Cat.No. : | PDE4A-366HF |
Product Overview : | Recombinant full length Human PDE4A, isoform 4 with N terminal proprietary tag. Predicted MW 97.24 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 97.240kDa inclusive of tags |
Protein Length : | 647 amino acids |
AA Sequence : | MPLVDFFCETCSKPWLVGWWDQFKRMLNRELTHLSEMSRS GNQVSEYISTTFLDKQNEVEIPSPTMKEREKQQAPRPRPS QPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKT DQEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIF QERDLLKKFRIPVDTMVTYMLTLEDHYHADVAYHNSLHAA DVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPG VSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNC DIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTM VETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPL ELYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVE KSQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNRDWY YSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEE EISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQE SLEVMAQEASLEAELEAVYLTQQAQSTGSAPVAPDEFSSR EEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGL PSTAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGG GSGGDPT |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Gene Name : | PDE4A phosphodiesterase 4A, cAMP-specific [ Homo sapiens ] |
Official Symbol : | PDE4A |
Synonyms : | PDE4A; phosphodiesterase 4A, cAMP-specific; DPDE2, phosphodiesterase 4A, cAMP specific (dunce (Drosophila) homolog phosphodiesterase E2); cAMP-specific 3,5-cyclic phosphodiesterase 4A; phosphodiesterase E2 dunce homolog (Drosophila) |
Gene ID : | 5141 |
mRNA Refseq : | NM_001111307 |
Protein Refseq : | NP_001104777 |
MIM : | 600126 |
UniProt ID : | P27815 |
Products Types
◆ Recombinant Protein | ||
PDE4A-6584M | Recombinant Mouse PDE4A Protein, His (Fc)-Avi-tagged | +Inquiry |
Pde4a-4745M | Recombinant Mouse Pde4a Protein, Myc/DDK-tagged | +Inquiry |
PDE4A-3990R | Recombinant Rat PDE4A Protein, His (Fc)-Avi-tagged | +Inquiry |
PDE4A-12553M | Recombinant Mouse PDE4A Protein | +Inquiry |
PDE4A6948H | Recombinant Human PDE4A (352-685).docx Protein | +Inquiry |
◆ Lysates | ||
PDE4A-3352HCL | Recombinant Human PDE4A 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1838 | PDE4A Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionThe inhibitors have been used in the treatment of asthma, and studies have shown that they can significantly reduce the number of asthma attacks and the use of drug D.
This protein has multiple conserved regions and different subtypes, which is of great significance for the selective inhibition of drugs.
Selective PDE4A inhibitors refer to drug molecules that target only the PDE4A protein and do not inhibit other PDE4 homologs.
It plays an important role in the activation and regulation of T cells by regulating cAMP levels, and is involved in T cell-mediated autoimmune responses.
Studies have shown that PDE4A depletion may be related to sleep-wake behavior and time stress response, but its specific role needs to be further studied.
In T cells, PDE4A is mainly expressed in the cytoplasm and peripheral regions of the nuclear membrane.
Customer Reviews (3)
Write a reviewPDE4A requires less storage environment.
The expression of PDE4A was stable.
It has the advantage of easy operation in the expression system and can improve the expression efficiency.
Ask a Question for All PDE4A Products
Required fields are marked with *
My Review for All PDE4A Products
Required fields are marked with *
Inquiry Basket