Recombinant Full Length Human PIM1 Protein, C-Flag-tagged
Cat.No. : | PIM1-959HFL |
Product Overview : | Recombinant Full Length Human PIM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is expressed primarily in B-lymphoid and myeloid cell lines, and is overexpressed in hematopoietic malignancies and in prostate cancer. It plays a role in signal transduction in blood cells, contributing to both cell proliferation and survival, and thus provides a selective advantage in tumorigenesis. Both the human and orthologous mouse genes have been reported to encode two isoforms (with preferential cellular localization) resulting from the use of alternative in-frame translation initiation codons, the upstream non-AUG (CUG) and downstream AUG codons. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.5 kDa |
AA Sequence : | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVE KDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQ EELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPP EWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPT FEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase |
Protein Pathways : | Acute myeloid leukemia, Jak-STAT signaling pathway |
Full Length : | Full L. |
Gene Name | PIM1 Pim-1 proto-oncogene, serine/threonine kinase [ Homo sapiens (human) ] |
Official Symbol | PIM1 |
Synonyms | PIM |
Gene ID | 5292 |
mRNA Refseq | NM_002648.4 |
Protein Refseq | NP_002639.1 |
MIM | 164960 |
UniProt ID | P11309 |
◆ Recombinant Proteins | ||
VEGFA-260H | Active Recombinant Human VEGF-121 Protein | +Inquiry |
SUPT4H1-8877M | Recombinant Mouse SUPT4H1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL27615XF | Recombinant Full Length Xenopus Tropicalis Zinc Transporter Zip14(Slc39A14) Protein, His-Tagged | +Inquiry |
ZFP583-18990M | Recombinant Mouse ZFP583 Protein | +Inquiry |
JAK2-2477H | Recombinant Human JAK2 protein(841-1130 aa), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
THBS1-5524H | Natve Human Thrombospondin | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
Avidin Biotin-27 | Native Avidin Protein | +Inquiry |
PMSG-01M | Native Pregnant Mare Serum Gonadotropin, Tag Free | +Inquiry |
EPX-8107H | Native Human Eosinophil Peroxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOLGA5-727HCL | Recombinant Human GOLGA5 cell lysate | +Inquiry |
PRSS22-509HCL | Recombinant Human PRSS22 lysate | +Inquiry |
CCNA1-682HCL | Recombinant Human CCNA1 cell lysate | +Inquiry |
P2RX2-3501HCL | Recombinant Human P2RX2 293 Cell Lysate | +Inquiry |
COPS3-7358HCL | Recombinant Human COPS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PIM1 Products
Required fields are marked with *
My Review for All PIM1 Products
Required fields are marked with *
0
Inquiry Basket