Recombinant Full Length Human PPM1D Protein, C-Flag-tagged
Cat.No. : | PPM1D-324HFL |
Product Overview : | Recombinant Full Length Human PPM1D Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. The expression of this gene is induced in a p53-dependent manner in response to various environmental stresses. While being induced by tumor suppressor protein TP53/p53, this phosphatase negatively regulates the activity of p38 MAP kinase, MAPK/p38, through which it reduces the phosphorylation of p53, and in turn suppresses p53-mediated transcription and apoptosis. This phosphatase thus mediates a feedback regulation of p38-p53 signaling that contributes to growth inhibition and the suppression of stress induced apoptosis. This gene is located in a chromosomal region known to be amplified in breast cancer. The amplification of this gene has been detected in both breast cancer cell line and primary breast tumors, which suggests a role of this gene in cancer development. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 66.5 kDa |
AA Sequence : | MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLPPRPSPAALPGGEVSGKGPAV AAREARDPLPDAGASPAPSRCCRRRSSVAFFAVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVCA AIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVIIRGMKMYVAHVGDSGVVLGIQDDPKDDFVRA VEVTQDHKPELPKERERIEGLGGSVMNKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWS YDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKML VNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVK SLEEDPWPRVNSKDHIPALVRSNAFSENFLEVSAEIARENVQGVVIPSKDPEPLEENCAKALTLRIHDSL NNSLPIGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEESNSGPLMKKHRRNGLSRSSG AQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRKTVCVCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Phosphatase |
Protein Pathways : | p53 signaling pathway |
Full Length : | Full L. |
Gene Name | PPM1D protein phosphatase, Mg2+/Mn2+ dependent 1D [ Homo sapiens (human) ] |
Official Symbol | PPM1D |
Synonyms | JDVS; WIP1; IDDGIP; PP2C-DELTA |
Gene ID | 8493 |
mRNA Refseq | NM_003620.4 |
Protein Refseq | NP_003611.1 |
MIM | 605100 |
UniProt ID | O15297 |
◆ Recombinant Proteins | ||
Ppm1d-5046M | Recombinant Mouse Ppm1d Protein, Myc/DDK-tagged | +Inquiry |
PPM1D-1744H | Recombinant Human PPM1D Protein, His (Fc)-Avi-tagged | +Inquiry |
PPM1D-2917H | Recombinant Human PPM1D protein, His-tagged | +Inquiry |
PPM1D-2668H | Recombinant Human PPM1D Protein, MYC/DDK-tagged | +Inquiry |
PPM1D-324HFL | Recombinant Full Length Human PPM1D Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPM1D Products
Required fields are marked with *
My Review for All PPM1D Products
Required fields are marked with *