Recombinant Full Length Human Proepiregulin(Ereg) Protein, His-Tagged
Cat.No. : | RFL19531HF |
Product Overview : | Recombinant Full Length Human Proepiregulin(EREG) Protein (O14944) (30-169aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (30-169) |
Form : | Lyophilized powder |
AA Sequence : | VLSTTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVALTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | EREG |
Synonyms | Epiregulin; EPR; ER ; Ereg; EREG_HUMAN; Proepiregulin |
UniProt ID | O14944 |
◆ Recombinant Proteins | ||
EREG-562H | Active Recombinant Human EREG protein(Val63-Leu108), hFc-tagged | +Inquiry |
Ereg-1999R | Recombinant Rat Ereg protein, His & T7-tagged | +Inquiry |
Ereg-198M | Recombinant Mouse Epiregulin | +Inquiry |
EREG-28692TH | Recombinant Human EREG | +Inquiry |
RFL19531HF | Recombinant Full Length Human Proepiregulin(Ereg) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EREG-1868HCL | Recombinant Human EREG cell lysate | +Inquiry |
EREG-1871MCL | Recombinant Mouse EREG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EREG Products
Required fields are marked with *
My Review for All EREG Products
Required fields are marked with *
0
Inquiry Basket