Recombinant Full Length Human PTGS1 Protein, C-Flag-tagged
Cat.No. : | PTGS1-593HFL |
Product Overview : | Recombinant Full Length Human PTGS1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This is one of two genes encoding similar enzymes that catalyze the conversion of arachinodate to prostaglandin. The encoded protein regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. Based on its ability to function as both a cyclooxygenase and as a peroxidase, the encoded protein has been identified as a moonlighting protein. The protein may promote cell proliferation during tumor progression. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 65.9 kDa |
AA Sequence : | MSRSLLLRFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTI PGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWES FSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFK TSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPP QSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQ LSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAEL EELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKT ATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Arachidonic acid metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | PTGS1 prostaglandin-endoperoxide synthase 1 [ Homo sapiens (human) ] |
Official Symbol | PTGS1 |
Synonyms | COX1; COX3; PHS1; PCOX1; PES-1; PGHS1; PTGHS; PGG/HS; PGHS-1 |
Gene ID | 5742 |
mRNA Refseq | NM_000962.4 |
Protein Refseq | NP_000953.2 |
MIM | 176805 |
UniProt ID | P23219 |
◆ Recombinant Proteins | ||
Ptgs1-819R | Recombinant Rat Ptgs1 protein, His & T7-tagged | +Inquiry |
Ptgs1-5225M | Recombinant Mouse Ptgs1 Protein, Myc/DDK-tagged | +Inquiry |
Ptgs1-734M | Recombinant Mouse Ptgs1 protein, His-tagged | +Inquiry |
PTGS1-012H | Recombinant Human PTGS1 Protein, His-tagged | +Inquiry |
PTGS1-13650M | Recombinant Mouse PTGS1 Protein | +Inquiry |
◆ Native Proteins | ||
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
PTGS1-58S | Native Sheep PTGS1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGS1-2706HCL | Recombinant Human PTGS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTGS1 Products
Required fields are marked with *
My Review for All PTGS1 Products
Required fields are marked with *
0
Inquiry Basket