Recombinant Full Length Human PUDP Protein, GST-tagged
| Cat.No. : | PUDP-3442HF |
| Product Overview : | Human HDHD1A full-length ORF ( NP_036212.2, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 214 amino acids |
| Description : | This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010] |
| Molecular Mass : | 50.1 kDa |
| AA Sequence : | MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PUDP pseudouridine 5'-phosphatase [ Homo sapiens (human) ] |
| Official Symbol | PUDP |
| Synonyms | PUDP; pseudouridine 5'-phosphatase; GS1; HDHD1; HDHD1A; FAM16AX; DXF68S1E; pseudouridine-5'-phosphatase; 5'-PsiMPase; family with sequence similarity 16, member A, X-linked; haloacid dehalogenase-like hydrolase domain containing 1; haloacid dehalogenase-like hydrolase domain containing 1A; haloacid dehalogenase-like hydrolase domain-containing protein 1; haloacid dehalogenase-like hydrolase domain-containing protein 1A; pseudouridine-5'-monophosphatase; EC 3.1.3.96 |
| Gene ID | 8226 |
| mRNA Refseq | NM_001135565 |
| Protein Refseq | NP_001129037 |
| MIM | 306480 |
| UniProt ID | Q08623 |
| ◆ Recombinant Proteins | ||
| PUDP-3442HF | Recombinant Full Length Human PUDP Protein, GST-tagged | +Inquiry |
| Pudp-5256M | Recombinant Mouse Pudp Protein, Myc/DDK-tagged | +Inquiry |
| PUDP-1564H | Recombinant Human PUDP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PUDP-4662H | Recombinant Human PUDP Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PUDP Products
Required fields are marked with *
My Review for All PUDP Products
Required fields are marked with *
