Recombinant Human PUDP Protein, GST-tagged

Cat.No. : PUDP-4662H
Product Overview : Human HDHD1A full-length ORF ( NP_036212.2, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010]
Molecular Mass : 50.1 kDa
AA Sequence : MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PUDP pseudouridine 5'-phosphatase [ Homo sapiens (human) ]
Official Symbol PUDP
Synonyms PUDP; pseudouridine 5'-phosphatase; GS1; HDHD1; HDHD1A; FAM16AX; DXF68S1E; pseudouridine-5'-phosphatase; 5'-PsiMPase; family with sequence similarity 16, member A, X-linked; haloacid dehalogenase-like hydrolase domain containing 1; haloacid dehalogenase-like hydrolase domain containing 1A; haloacid dehalogenase-like hydrolase domain-containing protein 1; haloacid dehalogenase-like hydrolase domain-containing protein 1A; pseudouridine-5'-monophosphatase; EC 3.1.3.96
Gene ID 8226
mRNA Refseq NM_001135565
Protein Refseq NP_001129037
MIM 306480
UniProt ID Q08623

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PUDP Products

Required fields are marked with *

My Review for All PUDP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon