Recombinant Human PUDP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PUDP-1564H
• Product Overview: HDHD1A MS Standard C13 and N15-labeled recombinant protein (NP_036212) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
• Molecular Mass: 23.8 kDa
• AA Sequence: MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PUDP pseudouridine 5'-phosphatase [ Homo sapiens (human) ]
• Official Symbol: PUDP
• Synonyms: PUDP; pseudouridine 5'-phosphatase; GS1; HDHD1; HDHD1A; FAM16AX; DXF68S1E; pseudouridine-5'-phosphatase; 5'-PsiMPase; family with sequence similarity 16, member A, X-linked; haloacid dehalogenase-like hydrolase domain containing 1; haloacid dehalogenase-like hydrolase domain containing 1A; haloacid dehalogenase-like hydrolase domain-containing protein 1; haloacid dehalogenase-like hydrolase domain-containing protein 1A; pseudouridine-5'-monophosphatase; EC 3.1.3.96
• Gene ID: 8226
• mRNA Refseq: NM_012080
• Protein Refseq: NP_036212
• MIM: 306480
• UniProt ID: Q08623