Recombinant Full Length Human RAB10 Protein, C-Flag-tagged
| Cat.No. : | RAB10-119HFL |
| Product Overview : | Recombinant Full Length Human RAB10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | RAB10 belongs to the RAS superfamily of small GTPases. RAB proteins localize to exocytic and endocytic compartments and regulate intracellular vesicle trafficking. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 22.4 kDa |
| AA Sequence : | MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome |
| Full Length : | Full L. |
| Gene Name | RAB10 RAB10, member RAS oncogene family [ Homo sapiens (human) ] |
| Official Symbol | RAB10 |
| Synonyms | Ac1075; RAB10, member RAS oncogene family; ras-related protein rab10 |
| Gene ID | 10890 |
| mRNA Refseq | NM_016131.5 |
| Protein Refseq | NP_057215.3 |
| MIM | 612672 |
| UniProt ID | P61026 |
| ◆ Recombinant Proteins | ||
| RAB10-7265H | Recombinant Human RAB10 protein, His&Myc-tagged | +Inquiry |
| RAB10-687Z | Recombinant Zebrafish RAB10 | +Inquiry |
| RAB10-13780M | Recombinant Mouse RAB10 Protein | +Inquiry |
| RAB10-2974H | Recombinant Full Length Human RAB10 Protein, T7-tagged | +Inquiry |
| RAB10-2771C | Recombinant Chicken RAB10 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB10-2632HCL | Recombinant Human RAB10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All RAB10 Products
Required fields are marked with *
My Review for All RAB10 Products
Required fields are marked with *