Recombinant Full Length Human RAB10 Protein, C-Flag-tagged

Cat.No. : RAB10-119HFL
Product Overview : Recombinant Full Length Human RAB10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : RAB10 belongs to the RAS superfamily of small GTPases. RAB proteins localize to exocytic and endocytic compartments and regulate intracellular vesicle trafficking.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 22.4 kDa
AA Sequence : MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI
AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Full Length : Full L.
Gene Name RAB10 RAB10, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB10
Synonyms Ac1075; RAB10, member RAS oncogene family; ras-related protein rab10
Gene ID 10890
mRNA Refseq NM_016131.5
Protein Refseq NP_057215.3
MIM 612672
UniProt ID P61026

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

Did you check the phosphorylation status of the produced protéin? RAB10-119HFL 02/23/2023

We didn't check the phosphorylation status of our RAB10 proteins. But the following one expressed in HEK293 should be phosphorylated. RAB10-119HFL

Ask a Question for All RAB10 Products

Required fields are marked with *

My Review for All RAB10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon