Recombinant Full Length Human RBBP7 Protein
Cat.No. : | RBBP7-428HF |
Product Overview : | Recombinant full length Human RbAp46 (amino acids 1-425) with N terminal proprietary tag; Predicted MWt 72.82 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 425 amino acids |
Description : | This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded protein is found in many histone deacetylase complexes, including mSin3 co-repressor complex. It is also present in protein complexes involved in chromatin assembly. This protein can interact with BRCA1 tumor-suppressor gene and may have a role in the regulation of cell proliferation and differentiation. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 72.820kDa inclusive of tags |
AA Sequence : | MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQ WPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVV ARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKI NHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKP DPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHT VCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHES LFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSF NPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIF QVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAED GPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQI WQMAENIYNDEESDVTTSELEGQGS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | RBBP7 retinoblastoma binding protein 7 [ Homo sapiens ] |
Official Symbol | RBBP7 |
Synonyms | RBBP7; retinoblastoma binding protein 7; histone-binding protein RBBP7; G1/S transition control protein binding protein RbAp46; histone acetyltransferase type B subunit 2; RbAp46; retinoblastoma binding protein p46; retinoblastoma binding protein RbAp46 |
Gene ID | 5931 |
mRNA Refseq | NM_001198719 |
Protein Refseq | NP_001185648 |
MIM | 300825 |
UniProt ID | Q16576 |
◆ Recombinant Proteins | ||
RBBP7-1010H | Recombinant Human RBBP7 Protein (1-425 aa), His-SUMO-tagged | +Inquiry |
RBBP7-4950R | Recombinant Rat RBBP7 Protein | +Inquiry |
RBBP7-588C | Recombinant Cynomolgus Monkey RBBP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBBP7-29048TH | Recombinant Human RBBP7 | +Inquiry |
RBBP7-3804R | Recombinant Rhesus monkey RBBP7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBBP7-2489HCL | Recombinant Human RBBP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBBP7 Products
Required fields are marked with *
My Review for All RBBP7 Products
Required fields are marked with *
0
Inquiry Basket