| Species : | 
                                    Human | 
                                
                                
                                    | Source : | 
                                    Mammalian Cells | 
                                
                                
                                    | Tag : | 
                                    Flag | 
                                
                                
                                    | Description : | 
                                    The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C-mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies. | 
                                
                                
                                    | Form : | 
                                    25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
                                
                                
                                    | Molecular Mass : | 
                                    10.4 kDa | 
                                
                                
                                    | AA Sequence : | 
                                    MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEV DFQEYVVLVAALTVACNNFFWENSTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
                                
                                
                                    | Purity : | 
                                    > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
                                
                                
                                    | Stability : | 
                                    Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
                                
                                
                                    | Storage : | 
                                    Store at -80 centigrade. | 
                                
                                
                                    | Concentration : | 
                                    >50 ug/mL as determined by microplate BCA method. | 
                                
                                
                                    | Preparation : | 
                                    Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
                                
                                
                                    | Full Length : | 
                                    Full L. |