Recombinant Human HPN
Cat.No. : | HPN-26788TH |
Product Overview : | Recombinant full length Human Hepsin with a N terminal proprietary tag. Predicted MW 67.69kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 378 amino acids |
Description : | This gene encodes a type II transmembrane serine protease. The encoded protein has an extracellular region that consists of two domains, a catalytic serine protease domain and a non-catalytic scavenger receptor cysteine-rich domain. This protein may be involved in diverse cellular functions including blood coagulation, maintenance of cell morphology and the growth and progression of certain cancers, particularly prostate cancer. Alternative splicing results in multiple transcript variants. |
Molecular Weight : | 67.690kDa inclusive of tags |
Tissue specificity : | Present in most tissues, with the highest level in liver. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSS RSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFC VDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLP VDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVL TAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVY HGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLP AAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISN DVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFAC EDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREW IFQAIKTHSEASGMVTQL |
Sequence Similarities : | Belongs to the peptidase S1 family.Contains 1 peptidase S1 domain.Contains 1 SRCR domain. |
Gene Name | HPN hepsin [ Homo sapiens ] |
Official Symbol | HPN |
Synonyms | HPN; hepsin; serine protease hepsin; TMPRSS1; transmembrane protease; serine 1; |
Gene ID | 3249 |
mRNA Refseq | NM_002151 |
Protein Refseq | NP_002142 |
MIM | 142440 |
Uniprot ID | P05981 |
Chromosome Location | 19q11-q13.2 |
Function | peptidase activity; scavenger receptor activity; serine-type endopeptidase activity; serine-type exopeptidase activity; serine-type peptidase activity; |
◆ Recombinant Proteins | ||
RFL11339HF | Recombinant Full Length Human Serine Protease Hepsin(Hpn) Protein, His-Tagged | +Inquiry |
HPN-4308M | Recombinant Mouse HPN Protein, His (Fc)-Avi-tagged | +Inquiry |
HPN-240HF | Recombinant Full Length Human HPN Protein | +Inquiry |
HPN-2559R | Recombinant Rat HPN Protein, His (Fc)-Avi-tagged | +Inquiry |
HPN-7831M | Recombinant Mouse HPN protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPN-5400HCL | Recombinant Human HPN 293 Cell Lysate | +Inquiry |
HPN-5399HCL | Recombinant Human HPN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HPN Products
Required fields are marked with *
My Review for All HPN Products
Required fields are marked with *
0
Inquiry Basket