Recombinant Full Length Human SH2D1B Protein, C-Flag-tagged
| Cat.No. : | SH2D1B-2183HFL |
| Product Overview : | Recombinant Full Length Human SH2D1B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | By binding phosphotyrosines through its free SRC (MIM 190090) homology-2 (SH2) domain, EAT2 regulates signal transduction through receptors expressed on the surface of antigen-presenting cells. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 15.1 kDa |
| AA Sequence : | MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEG SPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Pathways : | Natural killer cell mediated cytotoxicity |
| Full Length : | Full L. |
| Gene Name | SH2D1B SH2 domain containing 1B [ Homo sapiens (human) ] |
| Official Symbol | SH2D1B |
| Synonyms | EAT2 |
| Gene ID | 117157 |
| mRNA Refseq | NM_053282.5 |
| Protein Refseq | NP_444512.2 |
| MIM | 608510 |
| UniProt ID | O14796 |
| ◆ Recombinant Proteins | ||
| SH2D1B-2183HFL | Recombinant Full Length Human SH2D1B Protein, C-Flag-tagged | +Inquiry |
| SH2D1B-2640H | Recombinant Human SH2D1B protein, GST-tagged | +Inquiry |
| SH2D1B-5343C | Recombinant Chicken SH2D1B | +Inquiry |
| SH2D1B-6353H | Recombinant Human SH2D1B protein, His-tagged | +Inquiry |
| SH2D1B-1337H | Recombinant Human SH2D1B Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SH2D1B-1597HCL | Recombinant Human SH2D1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SH2D1B Products
Required fields are marked with *
My Review for All SH2D1B Products
Required fields are marked with *
