Recombinant Full Length Human SH2D1B Protein, C-Flag-tagged

• Cat.No.: SH2D1B-2183HFL
• Product Overview: Recombinant Full Length Human SH2D1B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: By binding phosphotyrosines through its free SRC (MIM 190090) homology-2 (SH2) domain, EAT2 regulates signal transduction through receptors expressed on the surface of antigen-presenting cells.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 15.1 kDa
• AA Sequence: MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEG SPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Natural killer cell mediated cytotoxicity
• Full Length: Full L.

Gene Information

• Gene Name: SH2D1B SH2 domain containing 1B [ Homo sapiens (human) ]
• Official Symbol: SH2D1B
• Synonyms: EAT2
• Gene ID: 117157
• mRNA Refseq: NM_053282.5
• Protein Refseq: NP_444512.2
• MIM: 608510
• UniProt ID: O14796