Recombinant Full Length Human SH2D1B Protein, C-Flag-tagged

Cat.No. : SH2D1B-2183HFL
Product Overview : Recombinant Full Length Human SH2D1B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : By binding phosphotyrosines through its free SRC (MIM 190090) homology-2 (SH2) domain, EAT2 regulates signal transduction through receptors expressed on the surface of antigen-presenting cells.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 15.1 kDa
AA Sequence : MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEG SPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Natural killer cell mediated cytotoxicity
Full Length : Full L.
Gene Name SH2D1B SH2 domain containing 1B [ Homo sapiens (human) ]
Official Symbol SH2D1B
Synonyms EAT2
Gene ID 117157
mRNA Refseq NM_053282.5
Protein Refseq NP_444512.2
MIM 608510
UniProt ID O14796

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SH2D1B Products

Required fields are marked with *

My Review for All SH2D1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon