Recombinant Full Length Human SIAE Protein, C-Flag-tagged
Cat.No. : | SIAE-1472HFL |
Product Overview : | Recombinant Full Length Human SIAE Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an enzyme which removes 9-O-acetylation modifications from sialic acids. Mutations in this gene are associated with susceptibility to autoimmune disease 6. Multiple transcript variants encoding different isoforms, found either in the cytosol or in the lysosome, have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 58.1 kDa |
AA Sequence : | MVAPGLVLGLVLPLILWADRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMK KVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNAT RELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYP IGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGES NINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYV PNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGL LNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYK QCPLYHPSSALPAPPFIAFITDQGPGHQSNVAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SIAE sialic acid acetylesterase [ Homo sapiens (human) ] |
Official Symbol | SIAE |
Synonyms | LSE; AIS6; CSEC; YSG2; CSE-C |
Gene ID | 54414 |
mRNA Refseq | NM_170601.5 |
Protein Refseq | NP_733746.1 |
MIM | 610079 |
UniProt ID | Q9HAT2 |
◆ Recombinant Proteins | ||
SIAE-3872Z | Recombinant Zebrafish SIAE | +Inquiry |
SIAE-1472HFL | Recombinant Full Length Human SIAE Protein, C-Flag-tagged | +Inquiry |
SIAE-5931H | Recombinant Human SIAE Protein (Ala22-Pro244), N-GST tagged | +Inquiry |
Siae-5873M | Recombinant Mouse Siae Protein, Myc/DDK-tagged | +Inquiry |
SIAE-4199R | Recombinant Rhesus monkey SIAE Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIAE-001HCL | Recombinant Human SIAE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIAE Products
Required fields are marked with *
My Review for All SIAE Products
Required fields are marked with *
0
Inquiry Basket