Recombinant Full Length Human SIX1 Protein
Cat.No. : | SIX1-476HF |
Product Overview : | Recombinant full length Human SIX1 with N-terminal proprietary tag, 56.98 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 284 amino acids |
Description : | The protein encoded by this gene is a homeobox protein that is similar to the Drosophila sine oculis gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in limb development. Defects in this gene are a cause of autosomal dominant deafness type 23 (DFNA23) and branchiootic syndrome type 3 (BOS3). |
Form : | Liquid |
Molecular Mass : | 56.980kDa inclusive of tags |
AA Sequence : | MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPAC DHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNH PKLQQLWLKAHYVEAEKLCGRPLGAVGKYRVRRKFPLPRT IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEA TGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQ NQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH ARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLV DLGS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | SIX1 SIX homeobox 1 [ Homo sapiens ] |
Official Symbol | SIX1 |
Synonyms | SIX1; SIX homeobox 1; deafness, autosomal dominant 23 , DFNA23, sine oculis homeobox (Drosophila) homolog 1 , sine oculis homeobox homolog 1 (Drosophila); homeobox protein SIX1 |
Gene ID | 6495 |
mRNA Refseq | NM_005982 |
Protein Refseq | NP_005973 |
MIM | 601205 |
UniProt ID | Q15475 |
◆ Recombinant Proteins | ||
SIX1-30869TH | Recombinant Human SIX1 | +Inquiry |
SIX1-7160H | Recombinant Human SIX Homeobox 1, His-tagged | +Inquiry |
SIX1-476HF | Recombinant Full Length Human SIX1 Protein | +Inquiry |
SIX1-3477C | Recombinant Chicken SIX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIX1-1825HCL | Recombinant Human SIX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIX1 Products
Required fields are marked with *
My Review for All SIX1 Products
Required fields are marked with *
0
Inquiry Basket