Recombinant Full Length Human SIX1 Protein
Cat.No. : | SIX1-476HF |
Product Overview : | Recombinant full length Human SIX1 with N-terminal proprietary tag, 56.98 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a homeobox protein that is similar to the Drosophila sine oculis gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in limb development. Defects in this gene are a cause of autosomal dominant deafness type 23 (DFNA23) and branchiootic syndrome type 3 (BOS3). |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 56.980kDa inclusive of tags |
Protein Length : | 284 amino acids |
AA Sequence : | MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPAC DHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNH PKLQQLWLKAHYVEAEKLCGRPLGAVGKYRVRRKFPLPRT IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEA TGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQ NQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH ARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLV DLGS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | SIX1 SIX homeobox 1 [ Homo sapiens ] |
Official Symbol : | SIX1 |
Synonyms : | SIX1; SIX homeobox 1; deafness, autosomal dominant 23 , DFNA23, sine oculis homeobox (Drosophila) homolog 1 , sine oculis homeobox homolog 1 (Drosophila); homeobox protein SIX1 |
Gene ID : | 6495 |
mRNA Refseq : | NM_005982 |
Protein Refseq : | NP_005973 |
MIM : | 601205 |
UniProt ID : | Q15475 |
Products Types
◆ Recombinant Protein | ||
SIX1-7160H | Recombinant Human SIX Homeobox 1, His-tagged | +Inquiry |
SIX1-3477C | Recombinant Chicken SIX1 | +Inquiry |
SIX1-30869TH | Recombinant Human SIX1 | +Inquiry |
◆ Lysates | ||
SIX1-1825HCL | Recombinant Human SIX1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket