Recombinant Human SIX1
Cat.No. : | SIX1-30869TH |
Product Overview : | Recombinant full length Human SIX1 with N-terminal proprietary tag, 56.98 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 284 amino acids |
Description : | The protein encoded by this gene is a homeobox protein that is similar to the Drosophila sine oculis gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in limb development. Defects in this gene are a cause of autosomal dominant deafness type 23 (DFNA23) and branchiootic syndrome type 3 (BOS3). |
Molecular Weight : | 56.980kDa inclusive of tags |
Tissue specificity : | Specifically expressed in skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPAC DHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNH PKLQQLWLKAHYVEAEKLCGRPLGAVGKYRVRRKFPLPRT IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEA TGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQ NQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH ARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLV DLGS |
Sequence Similarities : | Belongs to the SIX/Sine oculis homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | SIX1 SIX homeobox 1 [ Homo sapiens ] |
Official Symbol | SIX1 |
Synonyms | SIX1; SIX homeobox 1; deafness, autosomal dominant 23 , DFNA23, sine oculis homeobox (Drosophila) homolog 1 , sine oculis homeobox homolog 1 (Drosophila); homeobox protein SIX1; |
Gene ID | 6495 |
mRNA Refseq | NM_005982 |
Protein Refseq | NP_005973 |
MIM | 601205 |
Uniprot ID | Q15475 |
Chromosome Location | 14q23.1 |
Pathway | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function | DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
SIX1-476HF | Recombinant Full Length Human SIX1 Protein | +Inquiry |
SIX1-3477C | Recombinant Chicken SIX1 | +Inquiry |
SIX1-30869TH | Recombinant Human SIX1 | +Inquiry |
SIX1-7160H | Recombinant Human SIX Homeobox 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIX1-1825HCL | Recombinant Human SIX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIX1 Products
Required fields are marked with *
My Review for All SIX1 Products
Required fields are marked with *
0
Inquiry Basket