Recombinant Full Length Human SLC2A4 Protein, C-Flag-tagged
Cat.No. : | SLC2A4-805HFL |
Product Overview : | Recombinant Full Length Human SLC2A4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.6 kDa |
AA Sequence : | MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPS SIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLIL GRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLESLLGTASLWPLLLGLTV LPALLQLVLLPFCPESPRYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLG SRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRR TLHLLGLAGMCGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLL EQEVKPSTELEYLGPDENDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Adipocytokine signaling pathway, Insulin signaling pathway, Type II diabetes mellitus |
Full Length : | Full L. |
Gene Name | SLC2A4 solute carrier family 2 member 4 [ Homo sapiens (human) ] |
Official Symbol | SLC2A4 |
Synonyms | GLUT4 |
Gene ID | 6517 |
mRNA Refseq | NM_001042.3 |
Protein Refseq | NP_001033.1 |
MIM | 138190 |
UniProt ID | P14672 |
◆ Recombinant Proteins | ||
SLC2A4-2657H | Recombinant Human SLC2A4 Protein (Cys223-Leu287), SUMO tagged | +Inquiry |
SLC2A4-805HFL | Recombinant Full Length Human SLC2A4 Protein, C-Flag-tagged | +Inquiry |
SLC2A4-2746H | Recombinant Human SLC2A4, GST-tagged | +Inquiry |
SLC2A4-2658H | Recombinant Human SLC2A4 Protein (Cys223-Leu278), N-SUMO tagged | +Inquiry |
SLC2A4-2171H | Recombinant Human SLC2A4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A4 Products
Required fields are marked with *
My Review for All SLC2A4 Products
Required fields are marked with *