Recombinant Human SLC2A4 protein, GST-tagged
Cat.No. : | SLC2A4-112H |
Product Overview : | Recombinant Human SLC2A4(1 a.a. - 509 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-509 a.a. |
Description : | This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 81.2 kDa |
AA Sequence : | MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPG TLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLILGRFLIGAYSG LTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPE SPRYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVALLLLE RVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTSNFIIGMGFQYVAEAMGPYVF LLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SLC2A4 solute carrier family 2 (facilitated glucose transporter), member 4 [ Homo sapiens ] |
Official Symbol | SLC2A4 |
Synonyms | SLC2A4; solute carrier family 2 (facilitated glucose transporter), member 4; GLUT4; solute carrier family 2, facilitated glucose transporter member 4; GLUT-4; insulin-responsive glucose transporter type 4; glucose transporter type 4, insulin-responsive; |
Gene ID | 6517 |
mRNA Refseq | NM_001042 |
Protein Refseq | NP_001033 |
MIM | 138190 |
UniProt ID | P14672 |
Chromosome Location | 17p13 |
Pathway | AMPK signaling, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Adipogenesis, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function | D-glucose transmembrane transporter activity; glucose transmembrane transporter activity; protein binding; substrate-specific transmembrane transporter activity; |
◆ Recombinant Proteins | ||
SLC2A4-8314M | Recombinant Mouse SLC2A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC2A4-113H | Recombinant Human SLC2A4 protein, GST-tagged | +Inquiry |
SLC2A4-5157R | Recombinant Rat SLC2A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC2A4-2658H | Recombinant Human SLC2A4 Protein (Cys223-Leu278), N-SUMO tagged | +Inquiry |
Slc2a4-2695M | Recombinant Mouse Slc2a4 Protein, His&GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A4 Products
Required fields are marked with *
My Review for All SLC2A4 Products
Required fields are marked with *