Recombinant Full Length Human SMCO3 Protein

• Cat.No.: SMCO3-1768HF
• Product Overview: Human C12orf69 full-length ORF (ADR82872.1) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 225 amino acids
• Description: Predicted to be integral component of membrane.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 24.8 kDa
• AA Sequence: MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINTVKHQMK
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: SMCO3 single-pass membrane protein with coiled-coil domains 3 [ Homo sapiens (human) ]
• Official Symbol: SMCO3
• Synonyms: C12orf69
• Gene ID: 440087
• mRNA Refseq: NM_001013698.2
• Protein Refseq: NP_001013720.2
• UniProt ID: A2RU48.1