Recombinant Full Length Human SMCO3 Protein
Cat.No. : | SMCO3-1768HF |
Product Overview : | Human C12orf69 full-length ORF (ADR82872.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 225 amino acids |
Description : | Predicted to be integral component of membrane. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 24.8 kDa |
AA Sequence : | MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINTVKHQMK |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | SMCO3 single-pass membrane protein with coiled-coil domains 3 [ Homo sapiens (human) ] |
Official Symbol | SMCO3 |
Synonyms | C12orf69 |
Gene ID | 440087 |
mRNA Refseq | NM_001013698.2 |
Protein Refseq | NP_001013720.2 |
UniProt ID | A2RU48.1 |
◆ Recombinant Proteins | ||
Smco3-5965M | Recombinant Mouse Smco3 Protein, Myc/DDK-tagged | +Inquiry |
SMCO3-518H | Recombinant Human SMCO3 Protein | +Inquiry |
RFL14667MF | Recombinant Full Length Mouse Uncharacterized Protein C12Orf69 Homolog Protein, His-Tagged | +Inquiry |
SMCO3-1905H | Recombinant Human SMCO3 Protein, MYC/DDK-tagged | +Inquiry |
SMCO3-1768HF | Recombinant Full Length Human SMCO3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMCO3-79HCL | Recombinant Human SMCO3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMCO3 Products
Required fields are marked with *
My Review for All SMCO3 Products
Required fields are marked with *
0
Inquiry Basket