Recombinant Human SMCO3 Protein
| Cat.No. : | SMCO3-518H |
| Product Overview : | Human C12orf69 full-length ORF (ADR82872.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Molecular Mass : | 24.8 kDa |
| AA Sequence : | MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINTVKHQMK |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | SMCO3 single-pass membrane protein with coiled-coil domains 3 [ Homo sapiens (human) ] |
| Official Symbol | SMCO3 |
| Synonyms | C12orf69 |
| Gene ID | 440087 |
| mRNA Refseq | NM_001013698.2 |
| Protein Refseq | NP_001013720.2 |
| UniProt ID | A2RU48.1 |
| ◆ Recombinant Proteins | ||
| Smco3-5965M | Recombinant Mouse Smco3 Protein, Myc/DDK-tagged | +Inquiry |
| RFL33870HF | Recombinant Full Length Human Uncharacterized Protein C12Orf69(C12Orf69) Protein, His-Tagged | +Inquiry |
| SMCO3-518H | Recombinant Human SMCO3 Protein | +Inquiry |
| SMCO3-1905H | Recombinant Human SMCO3 Protein, MYC/DDK-tagged | +Inquiry |
| SMCO3-1768HF | Recombinant Full Length Human SMCO3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SMCO3-79HCL | Recombinant Human SMCO3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMCO3 Products
Required fields are marked with *
My Review for All SMCO3 Products
Required fields are marked with *
