Recombinant Human SMCO3 Protein

Cat.No. : SMCO3-518H
Product Overview : Human C12orf69 full-length ORF (ADR82872.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 24.8 kDa
AA Sequence : MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINTVKHQMK
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name SMCO3 single-pass membrane protein with coiled-coil domains 3 [ Homo sapiens (human) ]
Official Symbol SMCO3
Synonyms C12orf69
Gene ID 440087
mRNA Refseq NM_001013698.2
Protein Refseq NP_001013720.2
UniProt ID A2RU48.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMCO3 Products

Required fields are marked with *

My Review for All SMCO3 Products

Required fields are marked with *

0
cart-icon