Recombinant Human SMCO3 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | SMCO3-367H |
Product Overview : | C12orf69 MS Standard C13 and N15-labeled recombinant protein (NP_001013720) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Low expression observed in reference dataset. |
Molecular Mass : | 24.7 kDa |
AA Sequence : | MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINSETPNEMNSRFICHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SMCO3 single-pass membrane protein with coiled-coil domains 3 [ Homo sapiens (human) ] |
Official Symbol | SMCO3 |
Synonyms | SMCO3; single-pass membrane protein with coiled-coil domains 3; C12orf69; single-pass membrane and coiled-coil domain-containing protein 3 |
Gene ID | 440087 |
mRNA Refseq | NM_001013698 |
Protein Refseq | NP_001013720 |
UniProt ID | A2RU48 |
◆ Recombinant Proteins | ||
SMCO3-367H | Recombinant Human SMCO3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Smco3-5965M | Recombinant Mouse Smco3 Protein, Myc/DDK-tagged | +Inquiry |
RFL33870HF | Recombinant Full Length Human Uncharacterized Protein C12Orf69(C12Orf69) Protein, His-Tagged | +Inquiry |
SMCO3-1905H | Recombinant Human SMCO3 Protein, MYC/DDK-tagged | +Inquiry |
SMCO3-518H | Recombinant Human SMCO3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMCO3-79HCL | Recombinant Human SMCO3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMCO3 Products
Required fields are marked with *
My Review for All SMCO3 Products
Required fields are marked with *
0
Inquiry Basket