Recombinant Human SMCO3 Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SMCO3-367H |
| Product Overview : | C12orf69 MS Standard C13 and N15-labeled recombinant protein (NP_001013720) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Low expression observed in reference dataset. |
| Molecular Mass : | 24.7 kDa |
| AA Sequence : | MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINSETPNEMNSRFICHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SMCO3 single-pass membrane protein with coiled-coil domains 3 [ Homo sapiens (human) ] |
| Official Symbol | SMCO3 |
| Synonyms | SMCO3; single-pass membrane protein with coiled-coil domains 3; C12orf69; single-pass membrane and coiled-coil domain-containing protein 3 |
| Gene ID | 440087 |
| mRNA Refseq | NM_001013698 |
| Protein Refseq | NP_001013720 |
| UniProt ID | A2RU48 |
| ◆ Recombinant Proteins | ||
| SMCO3-1768HF | Recombinant Full Length Human SMCO3 Protein | +Inquiry |
| SMCO3-518H | Recombinant Human SMCO3 Protein | +Inquiry |
| RFL14667MF | Recombinant Full Length Mouse Uncharacterized Protein C12Orf69 Homolog Protein, His-Tagged | +Inquiry |
| Smco3-5965M | Recombinant Mouse Smco3 Protein, Myc/DDK-tagged | +Inquiry |
| SMCO3-367H | Recombinant Human SMCO3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SMCO3-79HCL | Recombinant Human SMCO3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMCO3 Products
Required fields are marked with *
My Review for All SMCO3 Products
Required fields are marked with *



